[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for cimm2:CIRT_10408

[Show Plain Result]


## Summary of Sequence Search
    1::221
    5::87      2e-21  51%   90 aa  PF00027 cNMP_binding "Cyclic nucleotide-binding domain"
   16::88      4e-04  31%   97 aa  PF04492 Phage_rep_O "Bacteriophage replication protein O      "
    1::221

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMG
PF00027         ----------------------------KKGEVIFKEGDPGDYFYIILSGSVKVYKEDEDGREQILAILG
PF04492         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLExxxxxxxxxxxxxxxxxxxxNDVVADLVF
PF00027         PGDFFGELALLTGKPRTATVIALEDSELLVLPREDFLELLE-----------------------------
PF04492         -------------------------------------------------------------NELLDALLA


                         +         .         .         .         .         *         .:210
query           SDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNKALADFASRGWLRLEPRSVxx
PF00027         ----------------------------------------------------------------------
PF04492         ADLTGRQLKVLLAIARKWNKKMDR-------ITNSQLAELTGISRDHVSRAKKELVRRGIIIQDGRKI--


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxx
PF00027         -----------
PF04492         -----------