[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_00337

[Show Plain Result]

#ERROR : Can't open dsspfile "2i7nA2.bssp"
#ERROR : Can't open dsspfile "2ewsA1.bssp"
#ERROR : Can't open dsspfile "2aa4A1.bssp"

## Summary of PDB Search
:462
    2e-34  41%  2i7nA2 [c.55.1.14] PANTOTHENATE KINASE 1 A:382 -- 593
    2e-24  20%  2ewsA1 [c.55.1.14] PANTOTHENATE KINASE A:1 -- 267
    2e-04  17%  2aa4A1 [c.55.1.10] PUTATIVE N-ACETYLMANNOSAMINE KINASE A:1 -- 119
:462

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2i7nA2          ----------------------------------------------------------------------
2ewsA1          ----------------------------------------------------------------------
2aa4A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxHVAVDIGGSLAKLVYFSPELGSSADGGRLNFLNFETERIDLCIDFLKQLKENH
2i7nA2          ----------------------------------------------------------------------
2ewsA1          -----------------KVGIDAGGTLIKIVQE--------QDNQRTFKTELTKNIDQVVEWLN------
2aa4A1          ------------------LAIDIGGTKLAAALIGA------DGQIRDRRELPTALRDALSALVSPLQAHA


                         +         .         .         .         .         *         .:210
query           RKLNGSAPGPLCIMATGGGAYKYYDRLKEELGVDIIREDEMECLIIGLDFFITEIPNEVFTYSETSPMEF
2i7nA2          -------------------------------------------------------PECYYFENPTNPELC
2ewsA1          ---------QQQIEKLCLTGGNAGV-IAENINIPAQIFVEFDAASQGLGILLKEQG--------------
2aa4A1          QRVAIASTGIIRDGSLGLLHFPLVKTLEQLTNLPTI----------------------------------


                         .         .         .         +         .         .         .:280
query           AEARPDVYPYLLVNIGSGVSMVKVSAPRRFERVXXXXXXXXXXXXXMSLLTGARTFDEMLAMAELGDNSG
2i7nA2          QYCLDNPYPMLLVNMGSGVSILAVYSKDNYKRVTGTSLGGGTFLGLCCLLTGCETFEEALEMAAKGDSTN
2ewsA1          ----HDLADYIFANVGTGTSLHYFDGQSQR-RVGGIGTGGGMIQGLGYLLSQITDYKQLTDMAQHGDRNT
2aa4A1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VDMLVGDIYGTDYTKIGLKSSTIASTFGKVFKMQRLAERSAQGXXXXXXXXXXXXRDVSQFRREDISRSL
2i7nA2          VDKLVKDIYGGDYERFGLQGSAVASSFGNMMSKEKRDS----------------------ISKEDLARAT
2ewsA1          IDLKVRHIIPGDL---------TAANFGHVLHHLD-----------------------ADFTPSNKLAAV
2aa4A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LFAISNNIGQIAYLQSEKHQIKHIYFGGSFIRGHRQTMNTLSYAIRFWSKGEKQAYFLRHEGYLGAVGAF
2i7nA2          LVTITNNIGSIARMCALNENIDRVVFVGNFLRINMVSMKLLAYAMDFWSKGQLKALFLEHEGYFGAVGAL
2ewsA1          IGVVGEVVTTMAITVAREFKTENIVYIGSSFHNNALLRKVVE---DYTVLRGCKPYYVENGAFSGAIGAL
2aa4A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           Lxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2i7nA2          L-----------------------------------------
2ewsA1          Y-----------------------------------------
2aa4A1          ------------------------------------------