[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_00379

[Show Plain Result]

#ERROR : Can't open dsspfile "1okcA.bssp"
#ERROR : Can't open dsspfile "2axoA1.bssp"
#ERROR : Can't open dsspfile "3ecfA1.bssp"
#ERROR : Can't open dsspfile "3ecfA1.bssp"

## Summary of PDB Search
:390
    4e-53  22%  1okcA  [f.42.1.1] ADP, ATP CARRIER PROTEIN HEART ISOFORM T1
    3e-31   7%  2axoA1 [c.47.1.19] HYPOTHETICAL PROTEIN ATU2684 A:38 -- 262
    3e-18  12%  3ecfA1 [d.17.4.21] NTF2-LIKE PROTEIN A:2 -- 129
    8e-12  10%  3ecfA1 [d.17.4.21] NTF2-LIKE PROTEIN A:2 -- 129(query 43->157)
:390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLETKSKPAVKPWAHFFAGAVGGMTAATL
1okcA           -------------------------------------------------ALSFLKDFLAGGVAAAISKTA
2axoA1          ------------------------------------------------ASCPPADEALRKXIQKGDVVGL
3ecfA1          ----------------------------------------------------------------------
3ecfA1          ------------------------------------------ISGNTLKGTEEVIPFLKGVTTRVAEVNI


                         .         .         *         .         .         .         .:140
query           TSPLDVLKTRLQSDFYQAQLRSLRAAHPLPQSHSILSLSRSAMVHFSETVQILRSIHVHEGWRALFKGLG
1okcA           VAPIERVKLLLQVQHASKQ--------------------ISAEKQYKGIIDCVVRIPKEQGFLSFWRGNL
2axoA1          SYHVDYWNYLGWTDSL----------------------------ASKENTERQYGYXRALGRNGVYTPQA
3ecfA1          ----------------------------------------------------------------------
3ecfA1          STTVEYPRASGVWQXR----------------------------TTKGTLYTLHNFFREEGIVYVWPXFD


                         +         .         .         .         .         *         .:210
query           PNLTGVVPARAINFYVYGNGKRILNDYFGYIPTETPASIHLXXXXXXXXXXXXXXNPIWLVKTRLQLDKS
1okcA           ANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWYFAGNLASGGAAGATSLCFVYPLDFARTRLAAD--
2axoA1          ILNGRDHVKGADVRGIYDRLDAFKREGQ----GLNVPVSSKFAGDEVEIDIGAGNGKADVVVAYFTREQT
3ecfA1          ----------------------------------------------------------------------
3ecfA1          PKAVXENPDALIQWLTG-----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NASNIPGRGRQYKNSLDCIRQTVRHEGIRGLYRGLTASYLGVTESSLQWVMYEEMKRILXXXXXXXXXDP
1okcA           --VGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVSVQGIIYRAAYFGVYDTAKGML-----------
2axoA1          V----DVKKXSYWHSVYDVQTVGXWDGSPXTVKLPASVVAKVKKGGCAVLLQTANASGD-----------
3ecfA1          ----------------EKYHEILK-KYFLSFETGDFSQ--------VQFSCNLEFLSPISGNTLKGTEEV
3ecfA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AHVRGWTDTAEHWVGTITXXXXXXXXXXXXTYPHEVVRTRLRQAPTIPAGGGKVQMKYTGLMQCFRVIWK
1okcA           -----PDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQSGRKGADI----MYTGTVDCWRKIAK
2axoA1          ----------------------------------------------------------------------
3ecfA1          IPLKGVTTRVAEVNIX--------------STTVEYPRASGVWQX----------RTTKGTLYTLHNFFR
3ecfA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           EEGMAGLYGGLTPHLLRVVPSAAIMFGMYEMIxxxxxxxx
1okcA           DEGPKAFFKGAWSNVLRGMGG-AFVLVLYDEI--------
2axoA1          ----------------------------------------
3ecfA1          EEGIVYVWPXFDPKAVXENPDALIQWLTGK----------
3ecfA1          ----------------------------------------