[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_00384

[Show Plain Result]

#ERROR : Can't open dsspfile "1cvjA1.bssp"
#ERROR : Can't open dsspfile "1u6fA1.bssp"
#ERROR : Can't open dsspfile "1x4hA1.bssp"
#ERROR : Can't open dsspfile "2cq4A1.bssp"
#ERROR : Can't open dsspfile "1hl6A.bssp"
#ERROR : Can't open dsspfile "1x4aA1.bssp"
#ERROR : Can't open dsspfile "2cpfA1.bssp"
#ERROR : Can't open dsspfile "1a9nB.bssp"
#ERROR : Can't open dsspfile "1wi8A.bssp"
#ERROR : Can't open dsspfile "2cpzA1.bssp"
#ERROR : Can't open dsspfile "1fj7A.bssp"
#ERROR : Can't open dsspfile "1fjcA.bssp"
#ERROR : Can't open dsspfile "2cq0A1.bssp"
#ERROR : Can't open dsspfile "1b7fA1.bssp"
#ERROR : Can't open dsspfile "2cpeA1.bssp"
#ERROR : Can't open dsspfile "1h2tZ.bssp"
#ERROR : Can't open dsspfile "1x4fA1.bssp"
#ERROR : Can't open dsspfile "1x4eA1.bssp"
#ERROR : Can't open dsspfile "2cpiA1.bssp"
#ERROR : Can't open dsspfile "1o0pA.bssp"
#ERROR : Can't open dsspfile "1qm9A2.bssp"
#ERROR : Can't open dsspfile "2ghpA2.bssp"
#ERROR : Can't open dsspfile "1h2vZ.bssp"
#ERROR : Can't open dsspfile "1u2fA.bssp"
#ERROR : Can't open dsspfile "1welA1.bssp"
#ERROR : Can't open dsspfile "1jmtA.bssp"
#ERROR : Can't open dsspfile "1oo0B.bssp"
#ERROR : Can't open dsspfile "1x5oA1.bssp"
#ERROR : Can't open dsspfile "2cpyA1.bssp"
#ERROR : Can't open dsspfile "1whxA.bssp"
#ERROR : Can't open dsspfile "2cpxA1.bssp"
#ERROR : Can't open dsspfile "2ditA1.bssp"
#ERROR : Can't open dsspfile "1wezA.bssp"
#ERROR : Can't open dsspfile "1x4gA1.bssp"
#ERROR : Can't open dsspfile "2aymA1.bssp"
#ERROR : Can't open dsspfile "2cqpA1.bssp"
#ERROR : Can't open dsspfile "2ghpA1.bssp"
#ERROR : Can't open dsspfile "1wwhA1.bssp"

## Summary of PDB Search
:406
    3e-09  21%  1cvjA1 [d.58.7.1] POLYDENYLATE BINDING PROTEIN 1 A:11 -- 90
    1e-08  22%  1u6fA1 [d.58.7.1] RNA-BINDING PROTEIN UBP1 A:1 -- 139
    6e-08  26%  1x4hA1 [d.58.7.1] RNA-BINDING PROTEIN 28 A:8 -- 105
    1e-07  18%  2cq4A1 [d.58.7.1] RNA BINDING MOTIF PROTEIN 23 A:132 -- 232
    2e-07  21%  1hl6A  [d.58.7.1] CG8781 PROTEIN
    3e-07  19%  1x4aA1 [d.58.7.1] SPLICING FACTOR, ARGININE/SERINE-RICH 1 A:9 --
    3e-07  24%  2cpfA1 [d.58.7.1] RNA BINDING MOTIF PROTEIN 19 A:362 -- 446
    6e-07  20%  1a9nB  [d.58.7.1] SPLICEOSOMAL U2B''
    3e-06  15%  1wi8A  [d.58.7.1] EUKARYOTIC TRANSLATION INITIATION FACTOR 4B
    4e-06  20%  2cpzA1 [d.58.7.1] CUG TRIPLET REPEAT RNA-BINDING PROTEIN 1 A:383 --
    4e-06  15%  1fj7A  [d.58.7.1] NUCLEOLIN RBD1
    4e-06  25%  1fjcA  [d.58.7.1] NUCLEOLIN RBD2
    4e-06  22%  2cq0A1 [d.58.7.1] EUKARYOTIC TRANSLATION INITIATION FACTOR 3 A:231
    5e-06  27%  1b7fA1 [d.58.7.1] PROTEIN (SXL-LETHAL PROTEIN) A:123 -- 204
    2e-05  25%  2cpeA1 [d.58.7.1] RNA-BINDING PROTEIN EWS A:353 -- 453
    2e-05  17%  1h2tZ  [d.58.7.1] 20 KDA NUCLEAR CAP BINDING PROTEIN
    3e-05   9%  1x4fA1 [d.58.7.1] MATRIN 3 A:8 -- 106
    5e-05  34%  1x4eA1 [d.58.7.1] RNA BINDING MOTIF, SINGLE-STRANDED INTERACTING
    6e-05  14%  2cpiA1 [d.58.7.1] CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 4 A:101 --
    6e-05  27%  1o0pA  [d.58.7.1] SPLICING FACTOR U2AF 65 KDA SUBUNIT
    7e-05  14%  1qm9A2 [d.58.7.1] POLYPYRIMIDINE TRACT-BINDING PROTEIN A:111 -- 198
    8e-05  14%  2ghpA2 [d.58.7.1] U4/U6 SNRNA-ASSOCIATED SPLICING FACTOR PRP24 A:41
    9e-05  21%  1h2vZ  [d.58.7.1] 20 KDA NUCLEAR CAP BINDING PROTEIN
    9e-05  22%  1u2fA  [d.58.7.1] PROTEIN (SPLICING FACTOR U2AF 65 KD SUBUNIT)
    1e-04  15%  1welA1 [d.58.7.1] RNA-BINDING PROTEIN 12 A:412 -- 523
    1e-04  17%  1jmtA  [d.58.7.3] SPLICING FACTOR U2AF 35 KDA SUBUNIT
    2e-04  26%  1oo0B  [d.58.7.1] CG8781-PA
    2e-04  18%  1x5oA1 [d.58.7.1] RNA BINDING MOTIF, SINGLE-STRANDED INTERACTING
    2e-04  14%  2cpyA1 [d.58.7.1] RNA-BINDING PROTEIN 12 A:536 -- 638
    3e-04  17%  1whxA  [d.58.7.1] HYPOTHETICAL PROTEIN RIKEN CDNA 1200009A02
    4e-04  18%  2cpxA1 [d.58.7.1] HYPOTHETICAL PROTEIN FLJ11016 A:291 -- 392
    4e-04  13%  2ditA1 [d.58.7.1] HIV TAT SPECIFIC FACTOR 1 VARIANT A:8 -- 106
    4e-04  18%  1wezA  [d.58.7.1] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN H'
    4e-04  17%  1x4gA1 [d.58.7.1] NUCLEOLYSIN TIAR A:8 -- 103
    8e-04  25%  2aymA1 [d.58.7.1] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A A:1 -- 83
    8e-04  23%  2cqpA1 [d.58.7.1] RNA-BINDING PROTEIN 12 A:917 -- 1002
    8e-04  19%  2ghpA1 [d.58.7.1] U4/U6 SNRNA-ASSOCIATED SPLICING FACTOR PRP24
    9e-04   8%  1wwhA1 [d.58.7.1] NUCLEOPORIN 35 A:169 -- 249
:406

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1cvjA1          ----------------------------------------------------------------------
1u6fA1          ----------------------------------------------------------------------
1x4hA1          ----------------------------------------------------------------------
2cq4A1          ----------------------------------------------------------------------
1hl6A           ----------------------------------------------------------------------
1x4aA1          ----------------------------------------------------------------------
2cpfA1          ----------------------------------------------------------------------
1a9nB           ----------------------------------------------------------------------
1wi8A           ----------------------------------------------------------------------
2cpzA1          ----------------------------------------------------------------------
1fj7A           ----------------------------------------------------------------------
1fjcA           ----------------------------------------------------------------------
2cq0A1          ----------------------------------------------------------------------
1b7fA1          ----------------------------------------------------------------------
2cpeA1          ----------------------------------------------------------------------
1h2tZ           ----------------------------------------------------------------------
1x4fA1          ----------------------------------------------------------------------
1x4eA1          ----------------------------------------------------------------------
2cpiA1          ----------------------------------------------------------------------
1o0pA           ----------------------------------------------------------------------
1qm9A2          ----------------------------------------------------------------------
2ghpA2          ----------------------------------------------------------------------
1h2vZ           ----------------------------------------------------------------------
1u2fA           ----------------------------------------------------------------------
1welA1          ----------------------------------------------------------------------
1jmtA           ----------------------------------------------------------------------
1oo0B           ----------------------------------------------------------------------
1x5oA1          ----------------------------------------------------------------------
2cpyA1          ----------------------------------------------------------------------
1whxA           ----------------------------------------------------------------------
2cpxA1          ----------------------------------------------------------------------
2ditA1          ----------------------------------------------------------------------
1wezA           ----------------------------------------------------------------------
1x4gA1          ----------------------------------------------------------------------
2aymA1          ----------------------------------------------------------------------
2cqpA1          ----------------------------------------------------------------------
2ghpA1          ----------------------------------------------------------------------
1wwhA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxKSASDNLQVPQQGVKRKESPTDRPTDPDATSALYISDLYWWTTDDEIRGWINATGCEGELKD
1cvjA1          --------------------------------------ASLYVGDLHPDVTEAMLYEKFSPAG---PILS
1u6fA1          ---------GQTAQLQQLQQQQQQHIPPTQMNPEPDVLRNLMVNYIPTTVDEVQLR---QLFERYGPIES
1x4hA1          -------------------------------PSDVTEGKTVFIRNLSFDSEEEALGEVL---QQFGDLKY
2cq4A1          ----------------------PVREPVDNLSPEERDARTVFCMQLAARIRPRDLEDFF---SAVGKVRD
1hl6A           --------EDGDQGIVRLKEKAKHGRGFGPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGE---IKN
1x4aA1          --------------------------GGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDL
2cpfA1          ----------------------------------------LFIKNLNFSTTEETLKGVFSKVGAIKSCTI
1a9nB           -------------------------------------NHTIYINNMNDKIKKEELKRSLYALF--SQFGH
1wi8A           ---------------------------------PKSPPYTAFLGNLPYDVTEESIKEFFRGLNI---SAV
2cpzA1          ----------------------QQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFM---PFGNVVS
1fj7A           ----------------------SHMLEDPVEGSESTTPFNLFIGNLNPNKSVAELKVAISELFA----KN
1fjcA           -----------------------HMLEDPCTSKKVRAARTLLAKNLSFNITEDELKEVFEDALE------
2cq0A1          ---------------------------------RADDNATIRVTNLSEDTRETDLQELFRPFGS---ISR
1b7fA1          ------------------------------------SNTNLIVNYLPQDMTDRELYALFR---AIGPINT
2cpeA1          -------------------------------PDEDSDNSAIYVQGLNDSVTLDDLADFFKQCGKRTGQPM
1h2tZ           ---------------LSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIM
1x4fA1          -----------------------EGKPDQKFDQKQELGRVIHLSNLPHSGYSDSA--VLKLAEPYGKIKN
1x4eA1          ----------------------------------------LYIRGLQPGTTDQDLVKLCQ---PYGKIVS
2cpiA1          -------------------------------SVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHI
1o0pA           -----------------------------------------------------------------GLVKS
1qm9A2          -------------------------------------SATLHLSNIPPSVSEEDLKVLFSSNGGVVKGFK
2ghpA2          --------------------------------------TTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDV
1h2vZ           ---------------------------------LLKKSCTLYVGNLSFYTTEEQIYELF---SKSGDIKK
1u2fA           ----------------------------------------LYVGNIPFGITEEAMMDFFNAQMGGLTQAP
1welA1          -----------------------SGQKRSRSRSPHEAGFCVYLKGLPFEAENKHVIDFFK---KLDIVED
1jmtA           --------------------------SQTIALLNI---YRNPQDGLRSAVSDVEMQEHYDEFFEEGEVEE
1oo0B           ---------------------------PGPQRSVEGWI--LFVTSIHEEAQEDEIQEKF---CDYGEIKN
1x5oA1          -----------------------SGVQAQMAKQQEQDPTNLYISNLPLSMDEQELENMLKPFGQVISTRI
2cpyA1          -------------------------------GDVNSAKVCAHITNIPFSITKMDVLQFL---EGIPVDEN
1whxA           ------------------------------SGSSGRSKTVILAKNLPAGTLAAEIQETFS---RFGSLGR
2cpxA1          ----------------------IRKIPMFSSYNPGEPNKVLYLKNLSPRVTERDLVSLF---ARFQEKKG
2ditA1          ----------------------RMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQIRKLLL
1wezA           ---------------------------------QSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIE
1x4gA1          ----------------------KQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRV
2aymA1          -------------------------------QTEQPPNQILFLTNLPEETNEMMLSMLFNQFPG------
2cqpA1          ------------------------------SSGKPGPTI-IKVQNMPFTVSIDEILDFFYGYQV---IPG
2ghpA1          ----------------------------------------LWXTNFPPSYTQRNIR----------DLLQ
1wwhA1          ----------------------------------------VTVFGFPQASASYILLQF----AQYGNILK


                         +         .         .         .         .         *         .:210
query           VTFSEHKVNGKSKGQAFVEFTSPQAATAAKHQIESLNAAQQSARKYSVNYTQPHTNPFRTLPKDNPMRGK
1cvjA1          IRVCRDMITRRSLGYAYVNFQQPADAERA---LDTMNFDVIKGKPVRIMWSQ------------------
1u6fA1          VKIVCDRETRQSRGYGFVKFQSGSSAQQA---IAGLNGFNILNKRLKVALAAS-----------------
1x4hA1          VRVVLHPDTEHSKGCAFAQFMTQEAAQKC-----------------------------------------
2cq4A1          VRIISDRNSRRSKGIAYVEFCEIQSVPLAI----GLTGQRLLGVPIIVQASQA-----------------
1hl6A           IHLNLDRRTGFSKGYALVEYETHKQALAA---KEALNGAEIMGQTIQVDWCFV-----------------
1x4aA1          KN------RRGGPPFAFVEFEDPRDAEDA-----------------------------------------
2cpfA1          SKKKNKAGVLLSMGFGFVEYKKPEQAQKA---LKQLQGHTVDGHKLEVRISERATKP-------------
1a9nB           VVDIVALKTMKMRGQAFVIFKELGSSTNA---LRQLQGFPFYGKPMRIQYAKT-----------------
1wi8A           RLPREPSNPERLKGFGYAEF--------------------------------------------------
2cpzA1          AKVFIDKQTNLSKCFGFVSYDNPVSAQAA---IQSMNGFQIGMKRLKVQLKRS-----------------
1fj7A           DLAVVDVRTGTNRKFGYVDFESAEDLEKA-----------------------------------------
1fjcA           --IRLVSQDGKSKGIAYIEFKSEADAEKN---LEEKQGAEIDGRSVSLYYTGE-----------------
2cq0A1          IYLAKDKTTGQSKGFAFISFHRREDAARA---IAGVSGFGYDHLILNVEWAKPSTN--------------
1b7fA1          CRIMRDYKTGYSYGYAFVDFTSEMDSQRA---IKVLNGITVRNKRLKVSYARP-----------------
2cpeA1          IHIYLDKETGKPKGDATVSYEDPPTAKAA---VEWFDGKDFQGSKLKVSLARK-----------------
1h2tZ           GL---DKMKKTACGFCFVEYYSRADAENA---MRYINGTRLDDRIIRTDWDAG-----------------
1x4fA1          YILMRMK---SQAFIEMETREDAMAMVDHCLK--------------------------------------
1x4eA1          TKAILDKTTNKCKGYGFVDFDSPSAAQKA---VTALK---------------------------------
2cpiA1          NNSTSYAGSQGPSASAYVTYIRSEDALRA---IQCVNNVVVDGRTLKAS---------------------
1o0pA           IERPVDGVEVPGCGKIFVEFTSVFDCQKA---MQGLTGRKFANRVVVTKYCDP-----------------
1qm9A2          FF-------QKDRKMALIQMGSVEEAVQALID--------------------------------------
2ghpA2          ADSLKKN-----FRFARIEFARYDGALAA-----------------------------------------
1h2vZ           IIMGLDKMKKTACGFCFVEYYSRADAENA---MRYINGTRLDDRIIRTDWDAG-----------------
1u2fA           GNPVLAVQINQDKNFAFLEFRSVDETTQA-----------------------------------------
1welA1          SIYIAYGPNGKATGEGFVEFRNEADYKAAL----CRHKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQ--
1jmtA           MNV-CDNLGDHLVGNVYVKFRREEDAEKA---VIDLNNRWFNGQPIHAEL--------------------
1oo0B           IHLNLDRRTGFSKGYALVEYETHKQALAA---KEALNGAEIMGQTIQVDWCFV-----------------
1x5oA1          LRDSSG----TSRGVGFARMESTEKCEAV---IGHFNGKFIKTPPGVSAPTEPLLCKF------------
2cpyA1          AVHVLVDNNGQGLGQALVQFKNEDDARKSE----RLHRKKLNGREAFVHVVTLEDMREIEKNPPAQGK--
1whxA           VLL------PEGGITAIVEFLEPLEARKA---FRHLAYSKFHHVPLYLEWAPIGVFGAAPQKKDSQHEQP
2cpxA1          PPIQFRMMTGRMRGQAFITFPNKEIAWQA---LHLVNGYKLYGKILVIEFGKN-----------------
2ditA1          FDRHPDG-------VASVSFRDPEEADYC---IQTLDGRWFGGRQITAQAWDG-----------------
1wezA           IGPDGRV-----TGEADVEFATHEDAVAA-----------------------------------------
1x4gA1          FPEKGYS---------FVRFSTHESAAHA---IVSVNGTTIEGHVVKCYWGKE-----------------
2aymA1          --FKEVRLVPNRHDIAFVEFTTELQSNAAKEA--------------------------------------
2cqpA1          SVCLKYNEKGMPTGEAMVAFESRDEATAA---VIDLNDRPIGSRKVKLVL--------------------
2ghpA1          DINVVALSIRLPRRFAYIDVTSKEDARYC---VEKLNGLKIEGYTLVTKVSNP-----------------
1wwhA1          HVM------SNTGNWMHIRYQSKLQARKA-----------------------------------------


                         .         .         .         +         .         .         .:280
query           DDRSRSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1cvjA1          ----------------------------------------------------------------------
1u6fA1          ----------------------------------------------------------------------
1x4hA1          ----------------------------------------------------------------------
2cq4A1          ----------------------------------------------------------------------
1hl6A           ----------------------------------------------------------------------
1x4aA1          ----------------------------------------------------------------------
2cpfA1          ----------------------------------------------------------------------
1a9nB           ----------------------------------------------------------------------
1wi8A           ----------------------------------------------------------------------
2cpzA1          ----------------------------------------------------------------------
1fj7A           ----------------------------------------------------------------------
1fjcA           ----------------------------------------------------------------------
2cq0A1          ----------------------------------------------------------------------
1b7fA1          ----------------------------------------------------------------------
2cpeA1          ----------------------------------------------------------------------
1h2tZ           ----------------------------------------------------------------------
1x4fA1          ----------------------------------------------------------------------
1x4eA1          ----------------------------------------------------------------------
2cpiA1          ----------------------------------------------------------------------
1o0pA           ----------------------------------------------------------------------
1qm9A2          ----------------------------------------------------------------------
2ghpA2          ----------------------------------------------------------------------
1h2vZ           ----------------------------------------------------------------------
1u2fA           ----------------------------------------------------------------------
1welA1          ----------------------------------------------------------------------
1jmtA           ----------------------------------------------------------------------
1oo0B           ----------------------------------------------------------------------
1x5oA1          ----------------------------------------------------------------------
2cpyA1          ----------------------------------------------------------------------
1whxA           AEKAESGP--------------------------------------------------------------
2cpxA1          ----------------------------------------------------------------------
2ditA1          ----------------------------------------------------------------------
1wezA           ----------------------------------------------------------------------
1x4gA1          ----------------------------------------------------------------------
2aymA1          ----------------------------------------------------------------------
2cqpA1          ----------------------------------------------------------------------
2ghpA1          ----------------------------------------------------------------------
1wwhA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1cvjA1          ----------------------------------------------------------------------
1u6fA1          ----------------------------------------------------------------------
1x4hA1          ----------------------------------------------------------------------
2cq4A1          ----------------------------------------------------------------------
1hl6A           ----------------------------------------------------------------------
1x4aA1          ----------------------------------------------------------------------
2cpfA1          ----------------------------------------------------------------------
1a9nB           ----------------------------------------------------------------------
1wi8A           ----------------------------------------------------------------------
2cpzA1          ----------------------------------------------------------------------
1fj7A           ----------------------------------------------------------------------
1fjcA           ----------------------------------------------------------------------
2cq0A1          ----------------------------------------------------------------------
1b7fA1          ----------------------------------------------------------------------
2cpeA1          ----------------------------------------------------------------------
1h2tZ           ----------------------------------------------------------------------
1x4fA1          ----------------------------------------------------------------------
1x4eA1          ----------------------------------------------------------------------
2cpiA1          ----------------------------------------------------------------------
1o0pA           ----------------------------------------------------------------------
1qm9A2          ----------------------------------------------------------------------
2ghpA2          ----------------------------------------------------------------------
1h2vZ           ----------------------------------------------------------------------
1u2fA           ----------------------------------------------------------------------
1welA1          ----------------------------------------------------------------------
1jmtA           ----------------------------------------------------------------------
1oo0B           ----------------------------------------------------------------------
1x5oA1          ----------------------------------------------------------------------
2cpyA1          ----------------------------------------------------------------------
1whxA           ----------------------------------------------------------------------
2cpxA1          ----------------------------------------------------------------------
2ditA1          ----------------------------------------------------------------------
1wezA           ----------------------------------------------------------------------
1x4gA1          ----------------------------------------------------------------------
2aymA1          ----------------------------------------------------------------------
2cqpA1          ----------------------------------------------------------------------
2ghpA1          ----------------------------------------------------------------------
1wwhA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1cvjA1          --------------------------------------------------------
1u6fA1          --------------------------------------------------------
1x4hA1          --------------------------------------------------------
2cq4A1          --------------------------------------------------------
1hl6A           --------------------------------------------------------
1x4aA1          --------------------------------------------------------
2cpfA1          --------------------------------------------------------
1a9nB           --------------------------------------------------------
1wi8A           --------------------------------------------------------
2cpzA1          --------------------------------------------------------
1fj7A           --------------------------------------------------------
1fjcA           --------------------------------------------------------
2cq0A1          --------------------------------------------------------
1b7fA1          --------------------------------------------------------
2cpeA1          --------------------------------------------------------
1h2tZ           --------------------------------------------------------
1x4fA1          --------------------------------------------------------
1x4eA1          --------------------------------------------------------
2cpiA1          --------------------------------------------------------
1o0pA           --------------------------------------------------------
1qm9A2          --------------------------------------------------------
2ghpA2          --------------------------------------------------------
1h2vZ           --------------------------------------------------------
1u2fA           --------------------------------------------------------
1welA1          --------------------------------------------------------
1jmtA           --------------------------------------------------------
1oo0B           --------------------------------------------------------
1x5oA1          --------------------------------------------------------
2cpyA1          --------------------------------------------------------
1whxA           --------------------------------------------------------
2cpxA1          --------------------------------------------------------
2ditA1          --------------------------------------------------------
1wezA           --------------------------------------------------------
1x4gA1          --------------------------------------------------------
2aymA1          --------------------------------------------------------
2cqpA1          --------------------------------------------------------
2ghpA1          --------------------------------------------------------
1wwhA1          --------------------------------------------------------