[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_00411

[Show Plain Result]

#ERROR : Can't open dsspfile "1r0dA.bssp"
#ERROR : Can't open dsspfile "1hf8A2.bssp"
#ERROR : Can't open dsspfile "1hf8A1.bssp"
#ERROR : Can't open dsspfile "2b0hA1.bssp"
#ERROR : Can't open dsspfile "1sj8A2.bssp"
#ERROR : Can't open dsspfile "1dvpA1.bssp"
#ERROR : Can't open dsspfile "1elkA.bssp"
#ERROR : Can't open dsspfile "1eduA.bssp"
#ERROR : Can't open dsspfile "1jplA.bssp"

## Summary of PDB Search
:1056
    9e-53  37%  1r0dA  [a.216.1.1] HUNTINGTIN INTERACTING PROTEIN 12
    9e-15  24%  1hf8A2 [a.118.9.3] CLATHRIN ASSEMBLY PROTEIN SHORT FORM A:19 -- 149
    3e-14  14%  1hf8A1 [a.7.8.2] CLATHRIN ASSEMBLY PROTEIN SHORT FORM A:150 -- 281
    4e-14  14%  2b0hA1 [a.24.9.2] TALIN-1 A:1838 -- 1973
    6e-14  34%  1sj8A2 [a.216.1.1] TALIN 1 A:658 -- 782
    2e-13  12%  1dvpA1 [a.118.9.2] HEPATOCYTE GROWTH FACTOR-REGULATED TYROSINE A:1
    1e-12  12%  1elkA  [a.118.9.2] TARGET OF MYB1
    3e-10  16%  1eduA  [a.118.9.1] EH DOMAIN BINDING PROTEIN EPSIN
    2e-09  12%  1jplA  [a.118.9.2] ADP-RIBOSYLATION FACTOR BINDING PROTEIN GGA3
:1056

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxNIDMSRTEADLAVNIRKATSIEETAPKRKHVRSCIVYTWDHKSSASFWAGMKVQPVLAD
1r0dA           ----------------------------------------------------------------------
1hf8A2          -------------------SAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNS
1hf8A1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          ------------------RSSFCKNLENATSHLRLEPDWPSILLCDEINQKDVTPKNAFAAIKKKMNSPN
1elkA           ------------------SSPVGQRIEKATDGSLQSEDWALNMEICDIINETEEGPKDALRAVKKRIVKN
1eduA           -----------NIVHNYSEAEIKV--REATSNDPWGPSSSLXSEIADLTYNVVAFSEIXSXIRLNDHGKN
1jplA           -------------------------LNKATNPSNRQEDWEYIIGCDQINKELEGPQIAVRLLAHKIQSPQ


                         .         .         *         .         .         .         .:140
query           EVQTFKALITVHKVLQEGHPITVKEAQSHVPWLDSLVRGVAGEGLRGYGPLIREYVFYLESKLAFHRQHP
1r0dA           ----------------------------------------------------------------------
1hf8A2          WVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGDMSTFIRRYSRYLNEKAVSYRQ--
1hf8A1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          PHSSCYSLLVLESIVKNCGAPVHEEVFTK-ENCEMFSSFLE----STPHENVRQKMLELVQTWAAFRSSD
1elkA           FHEVMLALTVLETCVKNCGHRFHVLVASQ-DFVESVLVRTILPK-NNPPTIVHDKVLNLIQSWAAFRSSP
1eduA           WRHVYKAXTLXEYLIKTGSERVSQQCKEN-----------------------------------------
1jplA           EWEALQALTVLEACXKNCGRRFHNEVGKF-RFLNELIKVVPKYLGDRVSEKVKTKVIELLYSWT------


                         +         .         .         .         .         *         .:210
query           EFNGLFEYEEYISLKSINDPNxGYETITDLMALQDQIDAFQKLIFSHFRGGANNECRISALVPLVQESYG
1r0dA           ----------------------------------------------------------------------
1hf8A2          ----------------------------------------------------------------------
1hf8A1          ----------------------GADGVMRTMNTLKTVPIIQNQMDALLDFNVTNGVINAAFMLLFKDAIR
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          KYQAIKDTMTILKAKGHTFPE-------------------------------------------------
1elkA           DLTGV--VTIYEDLRR------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IYKFITSMLRAMHTTTGDEEALEPLRGRYDAQHYRLVRFYYECSNLRYLTSLITVPKLPQQPPNLLAEDE
1r0dA           ----------------------------------------------------------------------
1hf8A2          ----------------------------------------------------------------------
1hf8A1          LFAAYNEGIINLLEKYFDMKKNQCKEKKFLTRMTRISEFLKVAEQVGIDR--GDIPDLSQAPSSLLDALE
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           Dxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dA           ----------------------------------------------------------------------
1hf8A2          ----------------------------------------------------------------------
1hf8A1          Q---------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dA           ----------------------------------------------------------------------
1hf8A2          ----------------------------------------------------------------------
1hf8A1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dA           ----------------------------------------------------------------------
1hf8A2          ----------------------------------------------------------------------
1hf8A1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dA           ----------------------------------------------------------------------
1hf8A2          ----------------------------------------------------------------------
1hf8A1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dA           ----------------------------------------------------------------------
1hf8A2          ----------------------------------------------------------------------
1hf8A1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dA           ----------------------------------------------------------------------
1hf8A2          ----------------------------------------------------------------------
1hf8A1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dA           ----------------------------------------------------------------------
1hf8A2          ----------------------------------------------------------------------
1hf8A1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDLGDLVDRELSXXXXXXXXX
1r0dA           --------------------------------------------------ELGAVVDKEXAATSAAIEDA
1hf8A2          ----------------------------------------------------------------------
1hf8A1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------------------------------------------
1sj8A2          ----------------------------------------------------------------------
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           XXXXXXXXXXPRDGYSTYELRIHDSILEASIAVTTAIAELIKAATASQQEIVREGRGSSSRTAFYKKNNR
1r0dA           VRRIEDXXNQARHASSGVKLEVNERILNSCTDLXKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSR
1hf8A2          ----------------------------------------------------------------------
1hf8A1          ----------------------------------------------------------------------
2b0hA1          ----------------------------------FTMGDPEGSFVDYQTTMVRTAKAAVTVQEMVTKSNT
1sj8A2          ----------------------------------------------------------------------
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           WTEGLISAAKAVATSTNTLIETADGVISGRNSPEQLIVASNDVAASTAQLVAASRVKATFMSKTQDRLET
1r0dA           WTEGLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAASKVKANKHSPHLSRLQE
1hf8A2          ----------------------------------------------------------------------
1hf8A1          ----------------------------------------------------------------------
2b0hA1          SPEELGPLANQLTSDYGRLASQAKPAAVAAENEEHIKHRVQELGHGCSALVTKAGALQCSPVYTKKELIE
1sj8A2          ----LMQLANAVASAAAALVLKAKSVAQRTEDSTQVIAAATQCALSTSQLVACTKVVAPTISSPQEQLVE
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           ASKAVGAACRALVRQVQAIIAEKNRDETxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1r0dA           CSRTVNERAANVVASTKSGQEQIEDRDT------------------------------------------
1hf8A2          ----------------------------------------------------------------------
1hf8A1          ----------------------------------------------------------------------
2b0hA1          CARRVSEKVSHVLAALQAG---------------------------------------------------
1sj8A2          AGRLVAKAVEGCVSASQAA---------------------------------------------------
1dvpA1          ----------------------------------------------------------------------
1elkA           ----------------------------------------------------------------------
1eduA           ----------------------------------------------------------------------
1jplA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxx
1r0dA           ------
1hf8A2          ------
1hf8A1          ------
2b0hA1          ------
1sj8A2          ------
1dvpA1          ------
1elkA           ------
1eduA           ------
1jplA           ------