[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_00429

[Show Plain Result]

#ERROR : Can't open dsspfile "1a7wA.bssp"
#ERROR : Can't open dsspfile "1n1jB.bssp"
#ERROR : Can't open dsspfile "1n1jA.bssp"
#ERROR : Can't open dsspfile "1aoiD.bssp"
#ERROR : Can't open dsspfile "1tafA.bssp"
#ERROR : Can't open dsspfile "2bykB1.bssp"
#ERROR : Can't open dsspfile "1tafB.bssp"
#ERROR : Can't open dsspfile "1aoiB.bssp"
#ERROR : Can't open dsspfile "1aoiC.bssp"
#ERROR : Can't open dsspfile "1jfiB.bssp"
#ERROR : Can't open dsspfile "1aoiA.bssp"
#ERROR : Can't open dsspfile "1f1eA.bssp"
#ERROR : Can't open dsspfile "1jfiA.bssp"

## Summary of PDB Search
:476
    3e-08  21%  1a7wA  [a.22.1.2] HISTONE HMFB
    1e-07  20%  1n1jB  [a.22.1.3] NF-YC
    2e-07  21%  1n1jA  [a.22.1.3] NF-YB
    2e-07  14%  1aoiD  [a.22.1.1] HISTONE H2B
    6e-07  20%  1tafA  [a.22.1.3] TFIID TBP ASSOCIATED FACTOR 42
    1e-06  24%  2bykB1 [a.22.1.3] CHRAC-14 B:11 -- 99
    2e-06  16%  1tafB  [a.22.1.3] TFIID TBP ASSOCIATED FACTOR 62
    3e-06  34%  1aoiB  [a.22.1.1] HISTONE H4
    4e-06  14%  1aoiC  [a.22.1.1] HISTONE H2A
    6e-06  15%  1jfiB  [a.22.1.3] TRANSCRIPTION REGULATOR NC2 BETA CHAIN
    4e-05  16%  1aoiA  [a.22.1.1] HISTONE H3
    7e-05  29%  1f1eA  [a.22.1.2] HISTONE FOLD PROTEIN
    1e-04  11%  1jfiA  [a.22.1.3] TRANSCRIPTION REGULATOR NC2 ALPHA CHAIN
:476

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a7wA           ----------------------------------------------------------------------
1n1jB           ----------------------------------------------------------------------
1n1jA           ----------------------------------------------------------------------
1aoiD           ----------------------------------------------------------------------
1tafA           ----------------------------------------------------------------------
2bykB1          ----------------------------------------------------------------------
1tafB           ----------------------------------------------------------------------
1aoiB           ----------------------------------------------------------------------
1aoiC           ----------------------------------------------------------------------
1jfiB           ----------------------------------------------------------------------
1aoiA           ----------------------------------------------------------------------
1f1eA           ----------------------------------------------------------------------
1jfiA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a7wA           ----------------------------------------------------------------------
1n1jB           ----------------------------------------------------------------------
1n1jA           ----------------------------------------------------------------------
1aoiD           ----------------------------------------------------------------------
1tafA           ----------------------------------------------------------------------
2bykB1          ----------------------------------------------------------------------
1tafB           ----------------------------------------------------------------------
1aoiB           ----------------------------------------------------------------------
1aoiC           ----------------------------------------------------------------------
1jfiB           ----------------------------------------------------------------------
1aoiA           ----------------------------------------------------------------------
1f1eA           ----------------------------------------------------------------------
1jfiA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a7wA           ----------------------------------------------------------------------
1n1jB           ----------------------------------------------------------------------
1n1jA           ----------------------------------------------------------------------
1aoiD           ----------------------------------------------------------------------
1tafA           ----------------------------------------------------------------------
2bykB1          ----------------------------------------------------------------------
1tafB           ----------------------------------------------------------------------
1aoiB           ----------------------------------------------------------------------
1aoiC           ----------------------------------------------------------------------
1jfiB           ----------------------------------------------------------------------
1aoiA           ----------------------------------------------------------------------
1f1eA           ----------------------------------------------------------------------
1jfiA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a7wA           ----------------------------------------------------------------------
1n1jB           ----------------------------------------------------------------------
1n1jA           ----------------------------------------------------------------------
1aoiD           ----------------------------------------------------------------------
1tafA           ----------------------------------------------------------------------
2bykB1          ----------------------------------------------------------------------
1tafB           ----------------------------------------------------------------------
1aoiB           ----------------------------------------------------------------------
1aoiC           ----------------------------------------------------------------------
1jfiB           ----------------------------------------------------------------------
1aoiA           ----------------------------------------------------------------------
1f1eA           ----------------------------------------------------------------------
1jfiA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1a7wA           ----------------------------------------------------------------------
1n1jB           ----------------------------------------------------------------------
1n1jA           ----------------------------------------------------------------------
1aoiD           ----------------------------------------------------------------------
1tafA           ----------------------------------------------------------------------
2bykB1          ----------------------------------------------------------------------
1tafB           ----------------------------------------------------------------------
1aoiB           ----------------------------------------------------------------------
1aoiC           ----------------------------------------------------------------------
1jfiB           ----------------------------------------------------------------------
1aoiA           ----------------------------------------------------------------------
1f1eA           ----------------------------------------------------------------------
1jfiA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxKERVSKHGIPVPKLPRGIVKRLATRFARTGNGSRTRISKEALAALEKATDWFFEQAND
1a7wA           -------------------------LPIAPIGRIIKD------AGAERVSDDARITLAKILEEMGRDIAS
1n1jB           -------------------------LPLARIKKIM----KLDEDV-KMISAEAPVLFAKAAQIFITELTL
1n1jA           -------------------------LPIANVARIM----KNAIPQTGKIAKDAKECVQECVSEFISFITS
1aoiD           ------------------------KTRKESYAIYVYKVLKQVHPD-TGISSKAMSIMNSFVNDVFERIAG
1tafA           -----------------------PKDAQ-VIMSILKEL------NVQEYEPRVVNQLLEFTFRYVTSILD
2bykB1          --------------------------PNAVIGRLI----KEALPESASVSKEARAAIARAASVFAIFVTS
1tafB           -------------------------ISAESMKVIAES------IGVGSLSDDAAKELAEDVSIKLKRIVQ
1aoiB           -------------------------ITKPAIRRLARR------GGVKRISGLIYEETRGVLKVFLENVIR
1aoiC           ------------AKAKTRSSRAGLQFPVGRVHR----LLRKGNYA-ERVGAGAPVYLAAVLEYLTAEILE
1jfiB           -------------------------IPRAAINKMI----KETLPN-VRVANDARELVVNCCTEFIHLISS
1aoiA           ------------REIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLR-FQSSAVMALQEASEAYLVALFE
1f1eA           -----------------------------------------------RASSDAVDLYNKLICRATEELGE
1jfiA           ------------------------RFPPARIKKIM----QTDEEIG-KVAAAVPVIISRALELFLESLLK


                         .         .         +         .         .         .         .:490
query           DLSAYSKHSNRKTVDETDVIALMKRQRQIGKGTSVFALAQxxxxxxxxxxxxxxxx
1a7wA           EAIKLARHAGRKTIKAEDIELAVRRFK-----------------------------
1n1jB           RAWIHTEDNKRRTLQRNDIAMAITKFDQFDF-------------------------
1n1jA           EASERCHQEKRKTINGEDILFAMST-------------------------------
1aoiD           EASRLAHYNKRSTITSREIQTAVRLL------------------------------
1tafA           DAKVYANHARKKTIDLDDVRLATEVT------------------------------
2bykB1          SSTALAHKQNHKTITAKDILQTLTEL------------------------------
1tafB           DAAKFMNHAKRQKLSVRDIDMSLK--------------------------------
1aoiB           DAVTYTEHAKRKTVTAMDVVYALKRQ------------------------------
1aoiC           LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQ----------------
1jfiB           EANEICNKSEKKTISPEHVIQALES-------------------------------
1aoiA           DTNLCAIHAKRVTIMPKDIQLARRIR------------------------------
1f1eA           KAAEYADEDGRKTVQGEDV-------------------------------------
1jfiA           K---ACQVTQSRTMTTSHLKQCIE--------------------------------