[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_00708

[Show Plain Result]

#ERROR : Can't open dsspfile "1f4sP.bssp"
#ERROR : Can't open dsspfile "1pyiA1.bssp"
#ERROR : Can't open dsspfile "1hwtD1.bssp"
#ERROR : Can't open dsspfile "1wffA.bssp"

## Summary of PDB Search
:693
    4e-11  23%  1f4sP  [g.38.1.1] ETHANOL REGULON TRANSCRIPTIONAL FACTOR
    1e-08  42%  1pyiA1 [g.38.1.1] PROTEIN (PYRIMIDINE PATHWAY REGULATOR 1) A:30 --
    4e-08  39%  1hwtD1 [g.38.1.1] PROTEIN (HEME ACTIVATOR PROTEIN) D:55 -- 97
    3e-07  17%  1wffA  [g.80.1.1] RIKEN CDNA 2810002D23 PROTEIN
:693

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f4sP           ----------------------------------------------------------------------
1pyiA1          ----------------------------------------------------------------------
1hwtD1          ----------------------------------------------------------------------
1wffA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxPKSKRVRTGCLTCRERHLKCDETLPRCQNCQKSDRLCKRGVRLNFIDTQVAAPPYA
1f4sP           --------------DTRRRQNHSCDPCRKGKRRCDAPENRNEANENGWVSCSNCKRWN------------
1pyiA1          --------------------RTACKRCRLKKIKCDQEFPSCKRCAKLEVPC-------------------
1hwtD1          ---------------KRNRIPLSCTICRKRKVKCDKLRPHCQQCTKTGVAH-------------------
1wffA           --------------QTKKKIMKHCFLCGKKTGLATSFECRASHRYAEAHGCNYDYKSAGRRYLEEANPVS


                         +         .         .         .         .         *         .:210
query           VPSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f4sP           ----------------------------------------------------------------------
1pyiA1          ----------------------------------------------------------------------
1hwtD1          ----------------------------------------------------------------------
1wffA           GPSS------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f4sP           ----------------------------------------------------------------------
1pyiA1          ----------------------------------------------------------------------
1hwtD1          ----------------------------------------------------------------------
1wffA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f4sP           ----------------------------------------------------------------------
1pyiA1          ----------------------------------------------------------------------
1hwtD1          ----------------------------------------------------------------------
1wffA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f4sP           ----------------------------------------------------------------------
1pyiA1          ----------------------------------------------------------------------
1hwtD1          ----------------------------------------------------------------------
1wffA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f4sP           ----------------------------------------------------------------------
1pyiA1          ----------------------------------------------------------------------
1hwtD1          ----------------------------------------------------------------------
1wffA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f4sP           ----------------------------------------------------------------------
1pyiA1          ----------------------------------------------------------------------
1hwtD1          ----------------------------------------------------------------------
1wffA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f4sP           ----------------------------------------------------------------------
1pyiA1          ----------------------------------------------------------------------
1hwtD1          ----------------------------------------------------------------------
1wffA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1f4sP           ---------------------------------------------------------------
1pyiA1          ---------------------------------------------------------------
1hwtD1          ---------------------------------------------------------------
1wffA           ---------------------------------------------------------------