[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_00735

[Show Plain Result]

#ERROR : Can't open dsspfile "1i1jA.bssp"
#ERROR : Can't open dsspfile "1wfwA.bssp"
#ERROR : Can't open dsspfile "1ov3A2.bssp"
#ERROR : Can't open dsspfile "1jxmA1.bssp"
#ERROR : Can't open dsspfile "1g2bA.bssp"
#ERROR : Can't open dsspfile "1phtA.bssp"
#ERROR : Can't open dsspfile "1uffA.bssp"
#ERROR : Can't open dsspfile "1ug1A.bssp"
#ERROR : Can't open dsspfile "1xovA1.bssp"
#ERROR : Can't open dsspfile "1ycsB2.bssp"
#ERROR : Can't open dsspfile "1udlA.bssp"
#ERROR : Can't open dsspfile "1zuuA1.bssp"

## Summary of PDB Search
:505
    2e-07  16%  1i1jA  [b.34.2.1] MELANOMA DERIVED GROWTH REGULATORY PROTEIN
    4e-05  13%  1wfwA  [b.34.2.1] KALIRIN-9A
    7e-05  21%  1ov3A2 [b.34.2.1] NEUTROPHIL CYTOSOL FACTOR 1 A:215 -- 283
    7e-05  23%  1jxmA1 [b.34.2.1] POSTSYNAPTIC DENSITY PROTEIN A:430 -- 525
    1e-04  25%  1g2bA  [b.34.2.1] SPECTRIN ALPHA CHAIN
    1e-04  16%  1phtA  [b.34.2.1] PHOSPHATIDYLINOSITOL 3-KINASE P85-ALPHA SUBUNIT
    1e-04  14%  1uffA  [b.34.2.1] INTERSECTIN 2
    3e-04  14%  1ug1A  [b.34.2.1] KIAA1010 PROTEIN
    3e-04  14%  1xovA1 [b.34.11.4] PLY PROTEIN A:181 -- 314
    4e-04  21%  1ycsB2 [b.34.2.1] 53BP2 B:457 -- 519
    4e-04  21%  1udlA  [b.34.2.1] INTERSECTIN 2
    8e-04  30%  1zuuA1 [b.34.2.1] BZZ1 PROTEIN A:2 -- 57
:505

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1i1jA           ----------------------------------------------------------------------
1wfwA           ----------------------------------------------------------------------
1ov3A2          ----------------------------------------------------------------------
1jxmA1          ----------------------------------------------------------------------
1g2bA           ----------------------------------------------------------------------
1phtA           ----------------------------------------------------------------------
1uffA           ----------------------------------------------------------------------
1ug1A           ----------------------------------------------------------------------
1xovA1          ----------------------------------------------------------------------
1ycsB2          ----------------------------------------------------------------------
1udlA           ----------------------------------------------------------------------
1zuuA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1i1jA           ----------------------------------------------------------------------
1wfwA           ----------------------------------------------------------------------
1ov3A2          ----------------------------------------------------------------------
1jxmA1          ----------------------------------------------------------------------
1g2bA           ----------------------------------------------------------------------
1phtA           ----------------------------------------------------------------------
1uffA           ----------------------------------------------------------------------
1ug1A           ----------------------------------------------------------------------
1xovA1          ----------------------------------------------------------------------
1ycsB2          ----------------------------------------------------------------------
1udlA           ----------------------------------------------------------------------
1zuuA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1i1jA           ----------------------------------------------------------------------
1wfwA           ----------------------------------------------------------------------
1ov3A2          ----------------------------------------------------------------------
1jxmA1          ----------------------------------------------------------------------
1g2bA           ----------------------------------------------------------------------
1phtA           ----------------------------------------------------------------------
1uffA           ----------------------------------------------------------------------
1ug1A           ----------------------------------------------------------------------
1xovA1          ----------------------------------------------------------------------
1ycsB2          ----------------------------------------------------------------------
1udlA           ----------------------------------------------------------------------
1zuuA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1i1jA           ----------------------------------------------------------------------
1wfwA           ----------------------------------------------------------------------
1ov3A2          ----------------------------------------------------------------------
1jxmA1          ----------------------------------------------------------------------
1g2bA           ----------------------------------------------------------------------
1phtA           ----------------------------------------------------------------------
1uffA           ----------------------------------------------------------------------
1ug1A           ----------------------------------------------------------------------
1xovA1          ----------------------------------------------------------------------
1ycsB2          ----------------------------------------------------------------------
1udlA           ----------------------------------------------------------------------
1zuuA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1i1jA           ----------------------------------------------------------------------
1wfwA           ----------------------------------------------------------------------
1ov3A2          ----------------------------------------------------------------------
1jxmA1          ----------------------------------------------------------------------
1g2bA           ----------------------------------------------------------------------
1phtA           ----------------------------------------------------------------------
1uffA           ----------------------------------------------------------------------
1ug1A           ----------------------------------------------------------------------
1xovA1          ----------------------------------------------------------------------
1ycsB2          ----------------------------------------------------------------------
1udlA           ----------------------------------------------------------------------
1zuuA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxSSPEGVASGQSEQLPYFRDYYSQDDIHPNDKVAVLWAYQPRAADEFELERGD
1i1jA           --------------------------GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQ
1wfwA           -------------------------------------------------MTVIKDYYALKENEICVSQGE
1ov3A2          --------------------------------------EDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGE
1jxmA1          ------------------------------------------------YIRALFDYCGFLSQALSFRFGD
1g2bA           ------------------------------------------------LVLALYDYQEKSPREVTMKKGD
1phtA           ------------------------------------------------QYRALYDYKKEREEDIDLHLGD
1uffA           ------------------------------------------------GYRALYPFEARNHDEMSFNSGD
1ug1A           ------------------------------------------------LFQAERNFNAAQDLDVSLLEGD
1xovA1          ---------------------------------------NRHSGAVVDSVPMLSKMDFKSSPIKMYKAGS
1ycsB2          -------------------------------------------IMNKGVIYALWDYEPQNDDELPMKEGD
1udlA           ------------------SGQKGWFPASHVKLLGPSSERATPAFHPVCQVIAMYDYAANNEDELSFSKGQ
1zuuA1          ---------------------------------------------------VLYAYVQKDDDEITITPGD


                         .         .         +         .         .         .         .:490
query           MLKVVGIWDDGWATGIRLNETVEDYDGKHKAQRDSGVSNGTDRRGSSPAPTGEIKAFPLVCVCxxxxxxx
1i1jA           VVYVFSKLKGRGRLFWG-GSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYC-------
1wfwA           VVQVLAVNQQNMCLVYQP----------------------------------------------------
1ov3A2          AVEVIHKLLDGWWVIRKDDVT-------------------------------------------------
1jxmA1          VLHVIDAGDEEWWQARR-----------------------------------------------------
1g2bA           ILTLLNSTNKDWWKV-EVN---------------------------------------------------
1phtA           ILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTG----------------------------------
1uffA           IIQVDEKTVGEPGWLYGSFEKMPSSENEKAVSPKKALLPPTVSLSATSGPS-------------------
1ug1A           LVGVIKKKDPMGSQNRWLID--------------------------------------------------
1xovA1          SLLVYEHNKYWY----------------------------------------------------------
1ycsB2          CMTIIHREDEDEIEWWWARLN-------------------------------------------------
1udlA           LINVMNKDDPDWWQGEINGVT-------------------------------------------------
1zuuA1          KISLVARDTGSGWTKINNDTT-------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxx
1i1jA           ---------------
1wfwA           ---------------
1ov3A2          ---------------
1jxmA1          ---------------
1g2bA           ---------------
1phtA           ---------------
1uffA           ---------------
1ug1A           ---------------
1xovA1          ---------------
1ycsB2          ---------------
1udlA           ---------------
1zuuA1          ---------------