[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_00742

[Show Plain Result]

#ERROR : Can't open dsspfile "1ci0A.bssp"
#ERROR : Can't open dsspfile "1t9mA.bssp"
#ERROR : Can't open dsspfile "1wv4A.bssp"
#ERROR : Can't open dsspfile "2ptfA1.bssp"
#ERROR : Can't open dsspfile "1w9aA.bssp"
#ERROR : Can't open dsspfile "2htiA1.bssp"
#ERROR : Can't open dsspfile "2hq7A1.bssp"
#ERROR : Can't open dsspfile "2fhqA1.bssp"
#ERROR : Can't open dsspfile "1vl7A.bssp"
#ERROR : Can't open dsspfile "1rfeA.bssp"
#ERROR : Can't open dsspfile "1flmA.bssp"
#ERROR : Can't open dsspfile "1wv4A.bssp"
#ERROR : Can't open dsspfile "2hq7A1.bssp"
#ERROR : Can't open dsspfile "2fhqA1.bssp"
#ERROR : Can't open dsspfile "1vl7A.bssp"

## Summary of PDB Search
:241
    2e-26  52%  1ci0A  [b.45.1.1] PROTEIN (PNP OXIDASE)
    1e-25  34%  1t9mA  [b.45.1.1] PROBABLE PYRIDOXAMINE 5'-PHOSPHATE OXIDASE
    3e-17  52%  1wv4A  [b.45.1.1] PYRIDOXAMINE 5'-PHOSPHATE OXIDASE
    4e-16  15%  2ptfA1 [b.45.1.4] UNCHARACTERIZED PROTEIN MTH_863 A:15 -- 220
    1e-09  11%  1w9aA  [b.45.1.1] HYPOTHETICAL PROTEIN RV1155
    3e-09  18%  2htiA1 [b.45.1.1] BH0577 PROTEIN A:10 -- 165
    5e-09   9%  2hq7A1 [b.45.1.1] PROTEIN, RELATED TO GENERAL STRESS PROTEIN A:2 --
    1e-07  14%  2fhqA1 [b.45.1.1] PUTATIVE GENERAL STRESS PROTEIN A:3 -- 137
    2e-07  14%  1vl7A  [b.45.1.1] HYPOTHETICAL PROTEIN ALR5027
    5e-06  29%  1rfeA  [b.45.1.1] HYPOTHETICAL PROTEIN RV2991
    1e-04  15%  1flmA  [b.45.1.1] PROTEIN (FMN-BINDING PROTEIN)
    4e-17  42%  1wv4A  [b.45.1.1] PYRIDOXAMINE 5'-PHOSPHATE OXIDASE(query 2->124)
    2e-07  11%  2hq7A1 [b.45.1.1] PROTEIN, RELATED TO GENERAL STRESS PROTEIN A:2 --(query 70->148)
    2e-07  14%  2fhqA1 [b.45.1.1] PUTATIVE GENERAL STRESS PROTEIN A:3 -- 137(query 159->211)
    3e-05  18%  1vl7A  [b.45.1.1] HYPOTHETICAL PROTEIN ALR5027(query 159->203)
:241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xPSGRVSARIVYLKELDERGWVVYSNWGSRAGKGGQVFGTETGIDVNXXXXXXXXXXXXSVIPDDGQGKL
1ci0A           -PSGRVSSRILLFKELDHRGFTIYSNWG-TSRKAHD---------------------------------I
1t9mA           -GQGRPSTRIVVIAELGERGVVFATHADSQKGRE-----------------------------------L
1wv4A           ----------------------------------------------------------------------
2ptfA1          -DSMVGNAAPIGVLCTGDDTVTLYLYQGTRTVEN-----------------------------------V
1w9aA           ---------------------------------------------------------------------L
2htiA1          ---------------------------------------------------------------------I
2hq7A1          ----------------------------------------------------------------------
2fhqA1          ---------------------------------------------------------------------F
1vl7A           -EQGIPNGSYAPFVIDDAKNIYIYVSGLAVHTKN-----------------------------------I
1rfeA           ----------------------------------------------------------------------
1flmA           -----VNTWNSYLKVLDGNRIVVPVGGMHKTEAN-----------------------------------V
1wv4A           -EHGQPYQRIVLLKHYDEKGMVFYTNLGSR--KAHQ---------------------------------I
2hq7A1          ---------------------------------------------------------------------L
2fhqA1          ----------------------------------------------------------------------
1vl7A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EGNRWAALTFNWPSVERQVRVEGLIEMLSREESETYWRVRERGSQIGAWASQQSKVLWSTEPRDMEGVDA
1ci0A           ATNPNAAIVFFWKDLQRQVRVEGITEHVNRETSERYFKTRPRGSKIGAWASRQSDVI-------------
1t9mA           AQNPWASGVLYWRESSQQIILNGRAERLPDERADAQWLSRPYQTHPMSIASRQSETL-------------
1wv4A           ----------------------------------------------------------------------
2ptfA1          LNNGRFTVNVTLDPLIFTDSTLGDLEEDMFSHYRDFLHLRGADAFFTAEVVSVKKLVKRD----------
1w9aA           RRDPRASILVDADDGWSYAVAEGTAQLTPPAAAPDDDTVEALIALYRNIAGEHSDWDDYRQAXV------
2htiA1          EANPEVCFTICEDLAYXSVIIFGTIEPVSAIEEGTEAXQQXLDKYVPSLGSRT--AIYKISCRERTAKVN
2hq7A1          ----------------------------------------------------------------------
2fhqA1          LSNPKAGLCFQEK--GDSVALXGEVEVVTDEKLKQELWQDWFIEHFPGGPTDPGYVLLKFTANHATYWIE
1vl7A           EANPLVNVLFVDDFARRRLSFDCTATLIERESQKWNQVVDQFQERFGQIIEVLRGRIFQLTPKEGRFVI-
1rfeA           ----------------------------------------------------------------------
1flmA           ARDERVLMTLGSRKVGTGFLIRGSAAFRTD---------GPEFEAIARFKWARAALVITVV---------
1wv4A           ENNPRVSLLFPWHTLERQVMVIGKAERLSTLEVMKYSFFRVSLEQIEFWQGGEH----------------
2hq7A1          KKNNKICLYFVDDNKFAGLXLVGTIEILHDRASKEXLWTDGCEIYYPLGIDDPDYTALCFTAEWGNYYRH
2fhqA1          ----------------------------------------------------------------------
1vl7A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VPGAASRLKDINSQSGEEDDGRSVLENRVKEMEKRFADTEEIPLPPFWGGVRLVPESVEFWQGRKSRLHD
1ci0A           -------------------KNREELDELTQKNTERFKDAEDIPCPDYWGGLRIVPLEIEFWQGRPSRLHD
1t9mA           -------------------ADIHALRAEARRLAETD---GPLPRPPGYCLFELCLESVEFWGNGTERLHE
1wv4A           --------------------------------------TLEVMKYSFWGGFRVSLEQIEFWQGGEHRLHD
2ptfA1          ---------------------RESELHVVKARAGDVMRAESFRMALNRGIYAVIESLIAYTRAPRERIAE
1w9aA           --------------------------------------------TDRRVLLTLPISHVYGLPP-------
2htiA1          EP--------------------------------------------------------------------
2hq7A1          ---------------------------------------PLGIDDPDYTALCFTAEWGNYYRHLK-NITF
2fhqA1          GTFIHKKL--------------------------------------------------------------
1vl7A           ----------------------------------------------------------------------
1rfeA           ------------------------------------------QXXNKRVGVRIVARRTRSWDHRKLGLPH
1flmA           ----------------------------------------------------------------------
1wv4A           ----------------------------------------------------------------------
2hq7A1          LKNITFKI--------------------------------------------------------------
2fhqA1          ------------------TDEKLKQELWQDWFIEHFPG---GPTDPGYVLLKFTANHATYWIEG-TFIHK
1vl7A           ------------------ERESQKWNQVVDQFQERFGQIEVLRGLADFRIFQLTPKEGRFVIG-------


                         .         .         .         +         .         .         .:280
query           RFRYVRVHGENEHLGEGDEKTFRWRIQRLSP
1ci0A           RFVYRRKTENDP-----------WKVVRLAP
1t9mA           RLRYDRDEGG-------------WKHRYLQP
1wv4A           RFLYQRENDA-------------WKIDRLAP
2ptfA1          MNRVARKVG-----GPREKEAMRRIIQAL--
1w9aA           -------------------------------
2htiA1          -------------------------------
2hq7A1          KIDEI--------------------------
2fhqA1          -------------------------------
1vl7A           -------------------------------
1rfeA           -------------------------------
1flmA           -------------------------------
1wv4A           -------------------------------
2hq7A1          -------------------------------
2fhqA1          K------------------------------
1vl7A           -------------------------------