[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_00779

[Show Plain Result]

#ERROR : Can't open dsspfile "1b3uA.bssp"
#ERROR : Can't open dsspfile "1u6gC.bssp"
#ERROR : Can't open dsspfile "2bkuB1.bssp"
#ERROR : Can't open dsspfile "1wa5C.bssp"
#ERROR : Can't open dsspfile "1qgkA.bssp"
#ERROR : Can't open dsspfile "1qbkB.bssp"
#ERROR : Can't open dsspfile "1bk5A.bssp"
#ERROR : Can't open dsspfile "1rxdA.bssp"
#ERROR : Can't open dsspfile "1wyeA1.bssp"

## Summary of PDB Search
:1773
    3e-11  15%  1b3uA  [a.118.1.2] PROTEIN (PROTEIN PHOSPHATASE PP2A)
    6e-11  11%  1u6gC  [a.118.1.2] TIP120 PROTEIN
    1e-09  10%  2bkuB1 [a.118.1.1] IMPORTIN BETA-1 SUBUNIT B:1 -- 861
    3e-09  11%  1wa5C  [a.118.1.1] IMPORTIN ALPHA RE-EXPORTER
    6e-08  10%  1qgkA  [a.118.1.1] PROTEIN (IMPORTIN BETA SUBUNIT)
    7e-07   9%  1qbkB  [a.118.1.1] KARYOPHERIN BETA2
    6e-05  12%  1bk5A  [a.118.1.1] KARYOPHERIN ALPHA
    1e-04  25%  1rxdA  [c.45.1.1] PROTEIN TYROSINE PHOSPHATASE TYPE IVA, MEMBER 1
    4e-04  17%  1wyeA1 [c.72.1.1] 2-KETO-3-DEOXYGLUCONATE KINASE A:2 -- 309
:1773

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxIMSSETHEVLSKALQKVSDYRRLGDIPTEYIKHIQRLCEAPIMAVQS
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           -----------------------ITHNPTNATLNKFIEELKKYG---------VTTIVRVCEATKEGIHV
1wyeA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ADFKLESPPSDTDIERWITQLExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           LDWPFGAPPSNQIVDDWLSLVK------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxRRAAMDVLAKIFAKYPEQRPFILDEILVSLEKLPSNRQSARQFKLIDGKSIQLLSA
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           --------------LEAAQKFLERAAVENLPTFLVELSRVLANPGNSQVARVAAG---LQIKNSLTSKDP
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           LVIQLVQTTALRQTSSRLTVAKGSLQKATXXXXXXXXXXXXXXXXXXXRKTSPIKQLSKQVELLYDNAIH
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           DIKAQYQQRWLAIDANARREVKNYVLHTL---------------------GTETYRPSSASQCVAGIACA
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           SAQYVTKFIVQRAMTSTKSGDQPYRNLLDIFTEDLISVLGSTDWPGAELILRVLASQMITIADHDKSSAN
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           EIPVNQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDPEQLQDKSNEILTAIIQGMRKEEPSNN
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           AKNMSLELLGWMGSAISDLTSTAQHLSNTLEDGHTDLTDHLRNLFHDYSNRALHIQDIVSLDGPYRMTLE
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           VKLAATNALLNSLEFTKA-----NFDKESERHFIMQVVCEATQCPDTRVRVAALQNLVKIMSLYYQYMET
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           YLEEGDLGSWQLSSARGYLIAQWAKLVCSGYEDSAQGGSTKNPQGAGKLAKALSHILSNPKWLESNSAFD
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           YMGPALFAITIE------AMKSDIDEVALQGIEFW----------------SNVCDEEMDLAIEASEAAE
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           RISTQQARFAYLIIVLSSGFCKGFDTIVKVLLNSITSDQAKVRSRSLKSVIHMLERDPSLLDRDGSVISL
1b3uA           ------------------------EKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHAT-IIPK
1u6gC           ------------------------SYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDERKVVKM
2bkuB1          ------------------------------------------------------------------FAQL
1wa5C           -----------------------FTKEIAPDLTSNNIPHIILRVDAIKYIYTFRNQLTK--AQLIELMPI
1qgkA           QGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDDDWNPCKAAGVCLMLLATCCEDDIVPH--VLPF
1qbkB           --------------------------QILQLLKESQSPDTTIQRTVQQKLEQLNQYPDF-----NNYLIF
1bk5A           -----------------------SQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADFIEKAGGMEK
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           ILRCATDSSPMVRDSALSLIAKCMFLKPGLEENCCRAILACSSDPTVGVRKRAIGLMKDVYIQTSNQELK
1b3uA           VLAMSGDPNYLHRMTTLFCINVLSEVQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQ
1u6gC           ILKLLEDKNGEVQNLAVKCLGPLVSKVKEQVETIVDTLCTNMLSDKEQLRDISSIGLKTVIGELPSALAA
2bkuB1          LENSILSPDQNIRLTSETQLKK-LSNDNFLQFAGLSSQVLIDENTKLEGRILAALTLKNELVSKDSVKTQ
1wa5C           LATFLQTDEYVVYTYAAITIEKILTIRESNTSPAFIFHKEDISNSTEILLKNLIALILKHGSSPEKLAEN
1qgkA           IKEHIKNPDWRYRDAAVMAFGCILEGPEPLVIQAMPTLIELMKDPSVVVRDTAAWTVGRICELLPEAAIN
1qbkB           VLTKLKSEDEPTRSLSGLILKNNVKAHFQNFDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWP
1bk5A           IFNCQQNENDKIYEKAYKIIET------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           LTIIEQLLLRVTDYESSVAVQASQALEEIWFSPLHSSFTESTQGTPQSKVSLKNLMNLIVGSVRRNEGVI
1b3uA           SEVKPILEKLTQDQDVDVKYFAQEALTVL-----------------------------------------
1u6gC           NVCKKITGRLTSAIAKQEDVSVQLEALDIMADMLSRQGGLLVNFHPSILTCLLPQLTSPRLAVRKR--TI
2bkuB1          QFAQRWITQVSPEAKNQIKTNALTALVSI------------EPRIANAAAQLIAAIADIELPHGAWPELM
1wa5C           EFLMRSIFRVLQTSEDSIQPLFPQLLAQF-IEIVTIMAKNPS--NPRFTHYTFESIGAILNYTQRQDSMM
1qgkA           DVPLLQCLIEGLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIV-----------
1qbkB           -DLLPKLCSLLDSEDYNTCEGAFGALQKICE-------DSAEILDSDRPLNIXIPKFLQFFKHSSPKIRS
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           ATFEAFVKDELSAEAKSASLNFNVCKAVVAAMFDRIIHDSDKTDKRTLQSLLQSITVFARANAKLFTPDQ
1b3uA           ----------------------------------------------------------------------
1u6gC           IALGHLVM--------------SCFVDLIEHLLSELSKNDSMSTTRTYIQCIAAISRQAGHRIGEYLEKI
2bkuB1          KIMVDNTGAEQPENVKRASLLALVSSSNNILIAIVQGAQSTETSKAVRLAALNALADSLIFIKNNMERGE
1wa5C           PTFLTVFSEDIQEFIPYVFQIIAFVVEQSATIPESIKPLAQPLLAPNVWELKGNIPAVTRLLKSFIKSSI
1qgkA           ----------------------------------------------------------------------
1qbkB           HAVACVNQFIISRTQALXLHIDSFTENLFALAGD--------EEPEVRKNVCRALVXLLEVRMDRLLPHX
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           LETLHPYIGHLSNADDLMLFRSVVVIYRCVLPYLSTSHNTLLKDIQNDLFKSVSKLARTELNEVMACLWT
1b3uA           ----------------------------------------------------------------------
1u6gC           IPLVVKFCNVDDDELREYCIQAFESFVRRCPKEVYPHVSTIINICLKYLTYDMSWKVRRAAAKCLDAVVR
2bkuB1          RNYLMQVVCEATQAEDIEVQAAAFGCLCKIMSKYYTFMKPYMEALYALTIATMKSPNDKVASMTVEFWST
1wa5C           FPDLVPVLGIFQRLIASKAYE-VHGFDLLEHIMLLIDMNRLRPYIKQIAVLLLQRLQNSKTERYVKKLTV
1qgkA           ----------------------------------------------------------------------
1qbkB           HNIVEYXLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGXKYSDIDIILLKGDVEE
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           INGVLQNTERLVKLTISVLKGINQAVSAKVDPSTSADVLGRVRSYIRIAGCVGKHCDLESFLAFFSQSFP
1b3uA           ----------------------------------------------------------------------
1u6gC           HEMLPEFYKTVSPALISRFKEREENVKADVFHAYLSLLKQTRPVGETPLTMLQSQVPNIVKALHKQMKEK
2bkuB1          ICEEEIDIAYELAQFPQSPLQS--YNFALSSIKDVVPNLLNLLTRQNEDPEDDDWNVSMSAGACLQLFAQ
1wa5C           FFGLI-SNKLGSDFLIHFIDEVQDGLFQQIWGNFIITTLPTIGNLLDRKIALIGVLNMVINGQFFQSKYP
1qgkA           ----------------------------------------------------------------------
1qbkB           DETIPDSEQDIRPRFHRSRTVAQQHDEDDDDDDEIDDDDTISDWNLRKCSAAA----LDVLANVYRDELP
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           HMKATSVSGLMVDFISPFASSKYPHELRVMALESLGAICETWPAQYSREPAKIAFTSVFEEDSPDLQNIV
1b3uA           ----------------------------------------------------------------------
1u6gC           SVKTRQCCFNMLTELVNVLPGALTQHIPVLVPGIIFSLNDKSSSSNLKIDALSCLYVILCNHSPQVFHPH
2bkuB1          NCGNHILEPVLEFVEQNI--TADNWRNREAAVMAFGSIMDGPDKVQRTYYVHQALPSILNLMNDQSLQVK
1wa5C           TLISSTMNSIIETASSQSIANLKEISTFGSHFSKLVSISEKPFDPLPEIDVNNGVRLYVAEALNKYNAIS
1qgkA           ----------------------------------------------------------------------
1qbkB           H-------------ILPLLKELLFHVVKESGILVLGAIAEGCXQGXIPYLPELHLIQCLSDKKALVRSIT
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           LKGFLAFFSIHEGKSEKLIQTKDTNGKSEGSTRLGGSLKASENDGAAALIAQHFLQQMLHAALSKEDSHA
1b3uA           ----------------------------------------------------------------------
1u6gC           VQALVPPVVACVGDPFYKITSEALLVTQQLVKVIRPLDQPSSFDATPYIKDLFTCTIKRLKAADIDQEVK
2bkuB1          ETTAWCIGRIADSVAESIDP--------------------------------------------------
1wa5C           GNTFLNTIL-------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           CWTLSRYAHWVVSQPPDTYL--------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ------------------------------------------DDEFGYNAIEWLRGQGVDVSHMKIDPSA


                         .         .         .         .         +         .         .:1470
query           LTGIELIASINRQGLIHPKECAGVLVALETSTNASIANVAFETHKMLHQQHESMFDREYMRAVQDAFYYQ
1b3uA           ----------------------------------------------------------------------
1u6gC           ERAISCMGQINLGDNLGSDLPNTLQIFLERLKNEITRLTTVKALTLI-----------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          PTGIFFIQRHYPVPLKSESIYYRKGSAGSKLSPEDVDEEYVKSADLVHAISSTAKEA-VYKAFEIASNRS


                         .         .         *         .         .         .         .:1540
query           RDVVGDPTGASTRPFTAKLAALFEIIKISNSKYQKKFLTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          FDTNIRLKLWSAEEAKREILKLL-------SKFHLKFLI-------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:1680
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1750
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b3uA           ----------------------------------------------------------------------
1u6gC           ----------------------------------------------------------------------
2bkuB1          ----------------------------------------------------------------------
1wa5C           ----------------------------------------------------------------------
1qgkA           ----------------------------------------------------------------------
1qbkB           ----------------------------------------------------------------------
1bk5A           ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1wyeA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1820
query           xxxxxxxxxxxxxxxxxxxxxxx
1b3uA           -----------------------
1u6gC           -----------------------
2bkuB1          -----------------------
1wa5C           -----------------------
1qgkA           -----------------------
1qbkB           -----------------------
1bk5A           -----------------------
1rxdA           -----------------------
1wyeA1          -----------------------