[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_00781

[Show Plain Result]

#ERROR : Can't open dsspfile "1l5jA1.bssp"
#ERROR : Can't open dsspfile "1te4A.bssp"
#ERROR : Can't open dsspfile "1oyzA.bssp"

## Summary of PDB Search
:335
    3e-07  13%  1l5jA1 [a.118.15.1] ACONITATE HYDRATASE 2 A:1 -- 160
    8e-07  18%  1te4A  [a.118.1.16] CONSERVED PROTEIN MTH187
    5e-04  19%  1oyzA  [a.118.1.16] HYPOTHETICAL PROTEIN YIBA
:335

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l5jA1          ----------------------------------------------------------------------
1te4A           ----------------------------------------------------------------------
1oyzA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1l5jA1          ----------------------------------------------------------------------
1te4A           ----------------------------------------------------------------------
1oyzA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAEQSIPELKQILLDASLPLFKRYRAMFA
1l5jA1          ------------------------------------------AERAAEGIAPKPLDANQ----MAALVEL
1te4A           ---------------------------------------------------------------RRDVSTA
1oyzA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LRDMCSPPDLPTAVPAIEALAEGFKDRSALFRHEIAFVFGQLSHPASIPSLVATLSDKNEVGMVRHXXXX
1l5jA1          LKNPPAG-EEEFLLDFLAAIAKGEAKSPLLTPEKAIELLGTMQGGYNIHPLIDALDDA----KLAPIAAK
1te4A           LSRMGDE--------AFEPLLESLSNEDWRIRGAAAWIIGNFQDERAVEPLIKLLEDDSG--FVRSGAAR
1oyzA           ----------------DDELFRLLDDHNSLKRISSARVLQLRGGQDAVRLAIEFCSDKNYI--RRDIGAF


                         .         *         .         .         .         .         +:350
query           XXXXXXXXDGVEETLKRFVNDPETVVRDSIIVALDMAEYEKSGEQEYILEQxxxx
1l5jA1          ALSHTLLMFDNFYDVEEKAKAGNEYAK-QVMQSWADAEWFLN-------------
1te4A           SLEQIGGERVRA-AMEKLAETGTGFARKVAVNYL---------------------
1oyzA           ILGQIKICKKCEDNNNXALNDKSACVRATAIESTAQRCKKNPIYSPKIVEQ----