[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_01210

[Show Plain Result]

#ERROR : Can't open dsspfile "1c25A.bssp"
#ERROR : Can't open dsspfile "2gwfA1.bssp"
#ERROR : Can't open dsspfile "1t3kA.bssp"
#ERROR : Can't open dsspfile "1gmxA.bssp"
#ERROR : Can't open dsspfile "1yt8A4.bssp"
#ERROR : Can't open dsspfile "1tq1A.bssp"
#ERROR : Can't open dsspfile "1hzmA.bssp"
#ERROR : Can't open dsspfile "1yt8A1.bssp"
#ERROR : Can't open dsspfile "1yt8A3.bssp"
#ERROR : Can't open dsspfile "1qxnA.bssp"
#ERROR : Can't open dsspfile "1yt8A2.bssp"
#ERROR : Can't open dsspfile "1e0cA2.bssp"
#ERROR : Can't open dsspfile "1okgA1.bssp"
#ERROR : Can't open dsspfile "1uarA2.bssp"
#ERROR : Can't open dsspfile "1urhA2.bssp"
#ERROR : Can't open dsspfile "1bohA2.bssp"
#ERROR : Can't open dsspfile "1bohA1.bssp"
#ERROR : Can't open dsspfile "1okgA2.bssp"
#ERROR : Can't open dsspfile "1e0cA1.bssp"

## Summary of PDB Search
:551
    2e-27  37%  1c25A  [c.46.1.1] CDC25A
    3e-16  13%  2gwfA1 [c.46.1.4] UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 8 A:181 --
    2e-14  21%  1t3kA  [c.46.1.1] DUAL-SPECIFICITY TYROSINE PHOSPHATASE
    2e-14  15%  1gmxA  [c.46.1.3] GLPE PROTEIN
    3e-13  20%  1yt8A4 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:243 -- 372
    5e-13  19%  1tq1A  [c.46.1.3] SENESCENCE-ASSOCIATED FAMILY PROTEIN
    1e-12  19%  1hzmA  [c.46.1.1] DUAL SPECIFICITY PROTEIN PHOSPHATASE 6
    3e-12  19%  1yt8A1 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:107 -- 242
    4e-12  16%  1yt8A3 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:373 -- 529
    2e-11  19%  1qxnA  [c.46.1.3] SULFIDE DEHYDROGENASE
    2e-11  23%  1yt8A2 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:6 -- 106
    2e-11  21%  1e0cA2 [c.46.1.2] SULFURTRANSFERASE A:136 -- 271
    2e-10  14%  1okgA1 [c.46.1.2] POSSIBLE 3-MERCAPTOPYRUVATE SULFURTRANSFERASE A:7
    4e-10  21%  1uarA2 [c.46.1.2] RHODANESE A:145 -- 285
    5e-10  19%  1urhA2 [c.46.1.2] 3-MERCAPTOPYRUVATE SULFURTRANSFERASE A:149 -- 268
    6e-09  18%  1bohA2 [c.46.1.2] RHODANESE A:150 -- 293
    3e-05  21%  1bohA1 [c.46.1.2] RHODANESE A:1 -- 149
    6e-04  24%  1okgA2 [c.46.1.2] POSSIBLE 3-MERCAPTOPYRUVATE SULFURTRANSFERASE
    9e-04  27%  1e0cA1 [c.46.1.2] SULFURTRANSFERASE A:1 -- 135
:551

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1c25A           ----------------------------------------------------------------------
2gwfA1          ----------------------------------------------------------------------
1t3kA           ----------------------------------------------------------------------
1gmxA           ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
1tq1A           ----------------------------------------------------------------------
1hzmA           ----------------------------------------------------------------------
1yt8A1          ----------------------------------------------------------------------
1yt8A3          ----------------------------------------------------------------------
1qxnA           ----------------------------------------------------------------------
1yt8A2          ----------------------------------------------------------------------
1e0cA2          ----------------------------------------------------------------------
1okgA1          ----------------------------------------------------------------------
1uarA2          ----------------------------------------------------------------------
1urhA2          ----------------------------------------------------------------------
1bohA2          ----------------------------------------------------------------------
1bohA1          ----------------------------------------------------------------------
1okgA2          ----------------------------------------------------------------------
1e0cA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1c25A           ----------------------------------------------------------------------
2gwfA1          ----------------------------------------------------------------------
1t3kA           ----------------------------------------------------------------------
1gmxA           ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
1tq1A           ----------------------------------------------------------------------
1hzmA           ----------------------------------------------------------------------
1yt8A1          ----------------------------------------------------------------------
1yt8A3          ----------------------------------------------------------------------
1qxnA           ----------------------------------------------------------------------
1yt8A2          ----------------------------------------------------------------------
1e0cA2          ----------------------------------------------------------------------
1okgA1          ----------------------------------------------------------------------
1uarA2          ----------------------------------------------------------------------
1urhA2          ----------------------------------------------------------------------
1bohA2          ----------------------------------------------------------------------
1bohA1          ----------------------------------------------------------------------
1okgA2          ----------------------------------------------------------------------
1e0cA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1c25A           ----------------------------------------------------------------------
2gwfA1          ----------------------------------------------------------------------
1t3kA           ----------------------------------------------------------------------
1gmxA           ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
1tq1A           ----------------------------------------------------------------------
1hzmA           ----------------------------------------------------------------------
1yt8A1          ----------------------------------------------------------------------
1yt8A3          ----------------------------------------------------------------------
1qxnA           ----------------------------------------------------------------------
1yt8A2          ----------------------------------------------------------------------
1e0cA2          ----------------------------------------------------------------------
1okgA1          ----------------------------------------------------------------------
1uarA2          ----------------------------------------------------------------------
1urhA2          ----------------------------------------------------------------------
1bohA2          ----------------------------------------------------------------------
1bohA1          ----------------------------------------------------------------------
1okgA2          ----------------------------------------------------------------------
1e0cA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1c25A           ----------------------------------------------------------------------
2gwfA1          ----------------------------------------------------------------------
1t3kA           ----------------------------------------------------------------------
1gmxA           ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
1tq1A           ----------------------------------------------------------------------
1hzmA           ----------------------------------------------------------------------
1yt8A1          ----------------------------------------------------------------------
1yt8A3          ----------------------------------------------------------------------
1qxnA           ----------------------------------------------------------------------
1yt8A2          ----------------------------------------------------------------------
1e0cA2          ----------------------------------------------------------------------
1okgA1          ----------------------------------------------------------------------
1uarA2          ----------------------------------------------------------------------
1urhA2          ----------------------------------------------------------------------
1bohA2          ----------------------------------------------------------------------
1bohA1          ----------------------------------------------------------------------
1okgA2          ----------------------------------------------------------------------
1e0cA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIADIDSQPTLQLPHFIPEDGPDQLPRVES
1c25A           -----------------------------------------IGDFSKGYLF----HTVAGKHQDLKYISP
2gwfA1          ----------------------------------------------------------------------
1t3kA           -------------------------------------------------------------ARSISYITS
1gmxA           --------------------------------------------------------------DQFECINV
1yt8A4          ----------------------------------------------------------------VERLDL
1tq1A           -----------------------------------------------------------------SSVSV
1hzmA           ------------------------------------------------------------------EMAI
1yt8A1          -------------------------------------------------------------ERHTPSLAA
1yt8A3          ----------------------------------------------------------------------
1qxnA           --------------------------------------------------------------ADMVMLSP
1yt8A2          ----------------------------------------------------------------------
1e0cA2          -----------------------------------------------------GPVALS--LHDEPTASR
1okgA1          -------------------------------------------------------------HPGKVFLDP
1uarA2          -----------------------------------------------------------------YRDDV
1urhA2          --------------------------------------------------------------NPEAVVKV
1bohA2          -------------------------------------------------------------LNRSLLKTY
1bohA1          ----------------------------------------------------------------------
1okgA2          ----------------------------------------------------------------------
1e0cA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           SVLVDIINGKYNDCYDKIMIIDCRFEYEYEGGHINGAVNYTDKEHLAAELFDQEPKPSTALIFHCEYSAH
1c25A           EIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPDGKRVIVVFHCEFSSE
2gwfA1          -----------TDKNISLIIMDARRMQDYQDSCILHSLSVEAHLPDDSKDTWKKRGNVEYVVLLDWFSSA
1t3kA           TQLLPLHRRP------NIAIIDVRDEERNYDGHIAGSLHSGSFDDKISHLVQNVKDKDT-LVFHSALSQV
1gmxA           ADAHQKLQEK------EAVLVDIRDPQSFAMGHAVQAFHL----TNDTLGAFMRDNDFDTPVMVMXYHGN
1yt8A4          AGLAQWQDEHDRT----TYLLDVRTPEEYEAGHLPGSRSGGQLVQETDHVASVRGAR---LVLVD-DDGV
1tq1A           TVAHDLLL-------AGHRYLDVRTPEEFSQGHACGAINVSKNTDFLEQVSSHFGQSDN--IIVGCQSGG
1hzmA           SKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINV-AIPGIMLRRLQKGNLPRDRFTRRCGTDTE
1yt8A1          EEVQALLDAR-----AEAVILDARRFDEYQTXSIPGGISVPG-AELVLRVAELAPDPRTRVIVNC-AGRT
1yt8A3          ---------------PGTRVLDFTASANYAKRHIPGAAWVLRSQLKQALERLGTAER---YVLTCG-SSL
1qxnA           KDAYKLLQEN-----PDITLIDVRDPDELKAMGKPDVKNHMSRGKLEPLLAKSGLDPEKPVVVFC-KTAA
1yt8A2          ----------------ELALLDVREEDPFAQAHPLFAANL-PLSRLELEIHARVPRRDTPITVYD-DGEG
1e0cA2          DYLLGRLGAA------DLAIWDARSPQEYRGGHIPGAVNALRIRTDIAGRLEELGITPDKEIVTHXQTHH
1okgA1          SEVADHL--------AEYRIVDCRYSLQYAKEHVKSAIRLPPXAEFIDWCXANGXAGELPVLCYDECGAX
1uarA2          LEHIIKVKEG------KGALVDVRSPQEYRGGHIPGAKNIFKSAEELRALYEPLGITKDKDIVVYXRIAE
1urhA2          TDVLLASHEN------TAQIIDARPAARFNAGHIPGALNVPWTE---LVREGELKTTDELDAIFFG-RGV
1bohA2          EQVLENLESK------RFQLVDSRAQGRYLGGHIRGSVNFEKSPEELRAMFEAKKVDLTKPLIATXRKGV
1bohA1          -----------------LRVLDASWYSEYLERHVPGASFLPSEAGFADYVGSLGISNDTHVVVYDGFYAP
1okgA2          ---------------PQAIITDARSADRFASGHIEGARNLPYTSHLVTRGDGKVLRSEEEI---------
1e0cA1          ----------------ELILVDLTSAARYAEGHIPGARFV----DPKRTQLGQPPAPAVYVVYDDEGWAG


                         .         .         +         .         .         .         .:490
query           RAPIMAKYIRHRDRAVNVDIYPKLTYPEMYILNGGYSSFFAEHRALCYPQNYVEMSAKEHEFACERGLGx
1c25A           RGPRMCRYVRERDRLGNE--YPKLHYPELYVLKGGYKEFFMKCQSYCEPPSYRPMHHEDF----------
2gwfA1          KDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGYENWLLCYPQYT-----------------------
1t3kA           RGPTCARRLVNYL----DEKKEDTGIKNIMILERGFNGWEASGKPVCRCAEVPCKG--------------
1gmxA           SSKGAAQYLL------------QQGYDVVYSIDGGFEAWQRQFPAEVAYG--------------------
1yt8A4          RANXSASWLAQXGWQV-------------AVLDGLSEADFSERGAWSAP---------------------
1tq1A           RSIKATTDLL------------HAGFTGVKDIVGGYSAWAKN----------------------------
1hzmA           SSSDWNENTGGESLLGLLLKKLKDEGCRAFYLEGGFSKFQAEFSLHC-----------------------
1yt8A1          RSIIGTQSLLNAGIPNPV-----------AALRNGTIGWTLAGQQLE-----------------------
1yt8A3          LARFAVAEVQ------------ALSGKPVFLLDGGTSAWVAAGLPTEDGESLLASPRIDRYRRPYEGTD-
1qxnA           RAALAGKTLR------------EYGFKTIYNSEGGMDKWLEE----------------------------
1yt8A2          LAPVAAQRLH------------DLGYSDVALLDGGLSGWRNA----------------------------
1e0cA2          RSGLTYLIAK------------ALGYPRVKGYAGSWGEWGNH----------------------------
1okgA1          GGCRLWWXLNSL-------------GADAYVINGGFQACKAAGLSGEPSSLPRPATHWPF----------
1uarA2          RSSHSWFVLKY-----------LLGYPHVKNYDGSWTEWGNL----------------------------
1urhA2          SYPIIVSXGSGVTAAVVLLALATLDVPNVKLYDGAWS---------------------------------
1bohA2          TACHIALAAY------------LCGKPDVAIYDGSWFEWFHRA----PPETWVSQGK-------------
1bohA1          RVWWMFRVFGHRT---------------VSVLNGGFRNWLKEGHPV------------------------
1okgA2          ----------------------------------------------------------------------
1e0cA1          RFIWLLDVIGQQR---------------YHYLNGGLTAWLAEDRPL------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1c25A           -------------------------------------------------------------
2gwfA1          -------------------------------------------------------------
1t3kA           -------------------------------------------------------------
1gmxA           -------------------------------------------------------------
1yt8A4          -------------------------------------------------------------
1tq1A           -------------------------------------------------------------
1hzmA           -------------------------------------------------------------
1yt8A1          -------------------------------------------------------------
1yt8A3          -------------------------------------------------------------
1qxnA           -------------------------------------------------------------
1yt8A2          -------------------------------------------------------------
1e0cA2          -------------------------------------------------------------
1okgA1          -------------------------------------------------------------
1uarA2          -------------------------------------------------------------
1urhA2          -------------------------------------------------------------
1bohA2          -------------------------------------------------------------
1bohA1          -------------------------------------------------------------
1okgA2          -------------------------------------------------------------
1e0cA1          -------------------------------------------------------------