[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_01225

[Show Plain Result]

#ERROR : Can't open dsspfile "1cvjA1.bssp"
#ERROR : Can't open dsspfile "1jmtA.bssp"
#ERROR : Can't open dsspfile "1u6fA1.bssp"
#ERROR : Can't open dsspfile "1h2vZ.bssp"
#ERROR : Can't open dsspfile "2cq0A1.bssp"
#ERROR : Can't open dsspfile "1o0pA.bssp"
#ERROR : Can't open dsspfile "1oo0B.bssp"
#ERROR : Can't open dsspfile "1hl6A.bssp"
#ERROR : Can't open dsspfile "1cvjF2.bssp"
#ERROR : Can't open dsspfile "1no8A.bssp"
#ERROR : Can't open dsspfile "2f9dA1.bssp"
#ERROR : Can't open dsspfile "1x4fA1.bssp"
#ERROR : Can't open dsspfile "1wi8A.bssp"
#ERROR : Can't open dsspfile "2cpfA1.bssp"
#ERROR : Can't open dsspfile "2cqpA1.bssp"
#ERROR : Can't open dsspfile "1qm9A1.bssp"
#ERROR : Can't open dsspfile "1h2tZ.bssp"
#ERROR : Can't open dsspfile "2cq4A1.bssp"
#ERROR : Can't open dsspfile "2ghpA2.bssp"
#ERROR : Can't open dsspfile "2cpzA1.bssp"
#ERROR : Can't open dsspfile "2cpxA1.bssp"
#ERROR : Can't open dsspfile "2cpdA1.bssp"
#ERROR : Can't open dsspfile "1b7fA1.bssp"
#ERROR : Can't open dsspfile "1uw4A.bssp"
#ERROR : Can't open dsspfile "3begB1.bssp"
#ERROR : Can't open dsspfile "1a9nB.bssp"
#ERROR : Can't open dsspfile "1x4eA1.bssp"
#ERROR : Can't open dsspfile "1welA1.bssp"
#ERROR : Can't open dsspfile "1u1kA.bssp"
#ERROR : Can't open dsspfile "2disA1.bssp"
#ERROR : Can't open dsspfile "2ghpA1.bssp"
#ERROR : Can't open dsspfile "1x4hA1.bssp"
#ERROR : Can't open dsspfile "1p1tA.bssp"
#ERROR : Can't open dsspfile "1fj7A.bssp"
#ERROR : Can't open dsspfile "2cpeA1.bssp"
#ERROR : Can't open dsspfile "1qm9A2.bssp"
#ERROR : Can't open dsspfile "2cpiA1.bssp"
#ERROR : Can't open dsspfile "1wwhA1.bssp"
#ERROR : Can't open dsspfile "1u2fA.bssp"
#ERROR : Can't open dsspfile "1ytyA2.bssp"
#ERROR : Can't open dsspfile "2dgxA1.bssp"
#ERROR : Can't open dsspfile "1x5pA1.bssp"
#ERROR : Can't open dsspfile "2cpyA1.bssp"
#ERROR : Can't open dsspfile "1sjrA.bssp"
#ERROR : Can't open dsspfile "1x5oA1.bssp"
#ERROR : Can't open dsspfile "2ditA1.bssp"
#ERROR : Can't open dsspfile "1whyA.bssp"
#ERROR : Can't open dsspfile "1fjcA.bssp"
#ERROR : Can't open dsspfile "1sjqA.bssp"
#ERROR : Can't open dsspfile "1x4aA1.bssp"
#ERROR : Can't open dsspfile "1wexA.bssp"
#ERROR : Can't open dsspfile "2aymA1.bssp"
#ERROR : Can't open dsspfile "1wf0A.bssp"
#ERROR : Can't open dsspfile "1whxA.bssp"
#ERROR : Can't open dsspfile "1x4gA1.bssp"
#ERROR : Can't open dsspfile "1wg1A.bssp"
#ERROR : Can't open dsspfile "1owxA.bssp"
#ERROR : Can't open dsspfile "1weyA.bssp"
#ERROR : Can't open dsspfile "1wezA.bssp"
#ERROR : Can't open dsspfile "2ghpA3.bssp"
#ERROR : Can't open dsspfile "1wf1A.bssp"
#ERROR : Can't open dsspfile "2cq2A1.bssp"
#ERROR : Can't open dsspfile "2cphA1.bssp"
#ERROR : Can't open dsspfile "2cqhA1.bssp"
#ERROR : Can't open dsspfile "2id0A3.bssp"
#ERROR : Can't open dsspfile "1ufwA.bssp"
#ERROR : Can't open dsspfile "1whvA.bssp"
#ERROR : Can't open dsspfile "1xdoA2.bssp"

## Summary of PDB Search
:252
    1e-22  33%  1cvjA1 [d.58.7.1] POLYDENYLATE BINDING PROTEIN 1 A:11 -- 90
    4e-15  19%  1jmtA  [d.58.7.3] SPLICING FACTOR U2AF 35 KDA SUBUNIT
    4e-15  25%  1u6fA1 [d.58.7.1] RNA-BINDING PROTEIN UBP1 A:1 -- 139
    6e-14  22%  1h2vZ  [d.58.7.1] 20 KDA NUCLEAR CAP BINDING PROTEIN
    7e-14  25%  2cq0A1 [d.58.7.1] EUKARYOTIC TRANSLATION INITIATION FACTOR 3 A:231
    1e-13  24%  1o0pA  [d.58.7.1] SPLICING FACTOR U2AF 65 KDA SUBUNIT
    2e-13  21%  1oo0B  [d.58.7.1] CG8781-PA
    3e-13  21%  1hl6A  [d.58.7.1] CG8781 PROTEIN
    5e-13  35%  1cvjF2 [d.58.7.1] POLYDENYLATE BINDING PROTEIN 1 F:91 -- 173
    1e-12  22%  1no8A  [d.58.7.1] ALY
    2e-12  17%  2f9dA1 [d.58.7.1] PRE-MRNA BRANCH SITE PROTEIN P14 A:12 -- 125
    3e-12  11%  1x4fA1 [d.58.7.1] MATRIN 3 A:8 -- 106
    3e-12  22%  1wi8A  [d.58.7.1] EUKARYOTIC TRANSLATION INITIATION FACTOR 4B
    3e-12  27%  2cpfA1 [d.58.7.1] RNA BINDING MOTIF PROTEIN 19 A:362 -- 446
    4e-12  20%  2cqpA1 [d.58.7.1] RNA-BINDING PROTEIN 12 A:917 -- 1002
    4e-12  26%  1qm9A1 [d.58.7.1] POLYPYRIMIDINE TRACT-BINDING PROTEIN A:1 -- 110
    8e-12  21%  1h2tZ  [d.58.7.1] 20 KDA NUCLEAR CAP BINDING PROTEIN
    8e-12  24%  2cq4A1 [d.58.7.1] RNA BINDING MOTIF PROTEIN 23 A:132 -- 232
    9e-12  14%  2ghpA2 [d.58.7.1] U4/U6 SNRNA-ASSOCIATED SPLICING FACTOR PRP24 A:41
    2e-11  32%  2cpzA1 [d.58.7.1] CUG TRIPLET REPEAT RNA-BINDING PROTEIN 1 A:383 --
    2e-11  17%  2cpxA1 [d.58.7.1] HYPOTHETICAL PROTEIN FLJ11016 A:291 -- 392
    3e-11  25%  2cpdA1 [d.58.7.1] APOBEC-1 STIMULATING PROTEIN A:223 -- 308
    4e-11  27%  1b7fA1 [d.58.7.1] PROTEIN (SXL-LETHAL PROTEIN) A:123 -- 204
    5e-11  12%  1uw4A  [d.58.7.4] UPF3X
    7e-11  19%  3begB1 [d.58.7.1] SPLICING FACTOR, ARGININE/SERINE-RICH 1 B:121 --
    9e-11  20%  1a9nB  [d.58.7.1] SPLICEOSOMAL U2B''
    1e-10  29%  1x4eA1 [d.58.7.1] RNA BINDING MOTIF, SINGLE-STRANDED INTERACTING
    1e-10  24%  1welA1 [d.58.7.1] RNA-BINDING PROTEIN 12 A:412 -- 523
    1e-10  30%  1u1kA  [d.58.7.1] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN A1
    2e-10  18%  2disA1 [d.58.7.1] UNNAMED PROTEIN PRODUCT A:8 -- 103
    3e-10  12%  2ghpA1 [d.58.7.1] U4/U6 SNRNA-ASSOCIATED SPLICING FACTOR PRP24
    6e-10  23%  1x4hA1 [d.58.7.1] RNA-BINDING PROTEIN 28 A:8 -- 105
    7e-10  31%  1p1tA  [d.58.7.1] CLEAVAGE STIMULATION FACTOR, 64 KDA SUBUNIT
    7e-10  25%  1fj7A  [d.58.7.1] NUCLEOLIN RBD1
    9e-10  22%  2cpeA1 [d.58.7.1] RNA-BINDING PROTEIN EWS A:353 -- 453
    1e-09  18%  1qm9A2 [d.58.7.1] POLYPYRIMIDINE TRACT-BINDING PROTEIN A:111 -- 198
    2e-09  14%  2cpiA1 [d.58.7.1] CCR4-NOT TRANSCRIPTION COMPLEX SUBUNIT 4 A:101 --
    2e-09  12%  1wwhA1 [d.58.7.1] NUCLEOPORIN 35 A:169 -- 249
    3e-09  17%  1u2fA  [d.58.7.1] PROTEIN (SPLICING FACTOR U2AF 65 KD SUBUNIT)
    3e-09  16%  1ytyA2 [d.58.7.1] LUPUS LA PROTEIN A:105 -- 189
    3e-09  19%  2dgxA1 [d.58.7.1] KIAA0430 PROTEIN A:563 -- 635
    4e-09  22%  1x5pA1 [d.58.7.1] NEGATIVE ELONGATION FACTOR E A:8 -- 91
    5e-09  15%  2cpyA1 [d.58.7.1] RNA-BINDING PROTEIN 12 A:536 -- 638
    8e-09  23%  1sjrA  [d.58.7.1] POLYPYRIMIDINE TRACT-BINDING PROTEIN 1
    1e-08  20%  1x5oA1 [d.58.7.1] RNA BINDING MOTIF, SINGLE-STRANDED INTERACTING
    1e-08  14%  2ditA1 [d.58.7.1] HIV TAT SPECIFIC FACTOR 1 VARIANT A:8 -- 106
    1e-08  20%  1whyA  [d.58.7.1] HYPOTHETICAL PROTEIN RIKEN CDNA 1810017N16
    1e-08  25%  1fjcA  [d.58.7.1] NUCLEOLIN RBD2
    2e-08  11%  1sjqA  [d.58.7.1] POLYPYRIMIDINE TRACT-BINDING PROTEIN 1
    2e-08  27%  1x4aA1 [d.58.7.1] SPLICING FACTOR, ARGININE/SERINE-RICH 1 A:9 --
    3e-08  15%  1wexA  [d.58.7.1] HYPOTHETICAL PROTEIN (RIKEN CDNA 2810036L13)
    3e-08  21%  2aymA1 [d.58.7.1] U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A A:1 -- 83
    4e-08  25%  1wf0A  [d.58.7.1] TAR DNA-BINDING PROTEIN-43
    5e-08  15%  1whxA  [d.58.7.1] HYPOTHETICAL PROTEIN RIKEN CDNA 1200009A02
    5e-08  30%  1x4gA1 [d.58.7.1] NUCLEOLYSIN TIAR A:8 -- 103
    7e-08  13%  1wg1A  [d.58.7.1] KIAA1579 PROTEIN
    7e-08  16%  1owxA  [d.58.7.1] LUPUS LA PROTEIN
    1e-07  16%  1weyA  [d.58.7.1] CALCIPRESSIN 1
    1e-07  17%  1wezA  [d.58.7.1] HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN H'
    1e-07  19%  2ghpA3 [d.58.7.1] U4/U6 SNRNA-ASSOCIATED SPLICING FACTOR PRP24
    2e-07  22%  1wf1A  [d.58.7.1] RNA-BINDING PROTEIN RALY
    3e-07  26%  2cq2A1 [d.58.7.1] HYPOTHETICAL PROTEIN LOC91801 A:25 -- 125
    3e-07  16%  2cphA1 [d.58.7.1] RNA BINDING MOTIF PROTEIN 19 A:454 -- 547
    8e-07  26%  2cqhA1 [d.58.7.1] IGF-II MRNA-BINDING PROTEIN 2 ISOFORM A A:2 -- 81
    1e-05  19%  2id0A3 [b.40.4.5] EXORIBONUCLEASE 2 A:5 -- 82
    2e-05  17%  1ufwA  [d.58.7.1] SYNAPTOJANIN 2
    4e-05  20%  1whvA  [d.58.7.1] POLY(A)-SPECIFIC RIBONUCLEASE
    3e-04  18%  1xdoA2 [d.322.1.2] POLYPHOSPHATE KINASE A:107 -- 314
:252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1cvjA1          ----------------------------------------------------------------------
1jmtA           ----------------------------------------------------------------------
1u6fA1          ----------------------------------------------------------------------
1h2vZ           ----------------------------------------------------------------------
2cq0A1          ----------------------------------------------------------------------
1o0pA           ----------------------------------------------------------------------
1oo0B           ----------------------------------------------------------------------
1hl6A           ----------------------------------------------------------------------
1cvjF2          ----------------------------------------------------------------------
1no8A           ----------------------------------------------------------------------
2f9dA1          ----------------------------------------------------------------------
1x4fA1          ----------------------------------------------------------------------
1wi8A           ----------------------------------------------------------------------
2cpfA1          ----------------------------------------------------------------------
2cqpA1          ----------------------------------------------------------------------
1qm9A1          ----------------------------------------------------------------------
1h2tZ           ----------------------------------------------------------------------
2cq4A1          ----------------------------------------------------------------------
2ghpA2          ----------------------------------------------------------------------
2cpzA1          ----------------------------------------------------------------------
2cpxA1          ----------------------------------------------------------------------
2cpdA1          ----------------------------------------------------------------------
1b7fA1          ----------------------------------------------------------------------
1uw4A           ----------------------------------------------------------------------
3begB1          ----------------------------------------------------------------------
1a9nB           ----------------------------------------------------------------------
1x4eA1          ----------------------------------------------------------------------
1welA1          ----------------------------------------------------------------------
1u1kA           ----------------------------------------------------------------------
2disA1          ----------------------------------------------------------------------
2ghpA1          ----------------------------------------------------------------------
1x4hA1          ----------------------------------------------------------------------
1p1tA           ----------------------------------------------------------------------
1fj7A           ----------------------------------------------------------------------
2cpeA1          ----------------------------------------------------------------------
1qm9A2          ----------------------------------------------------------------------
2cpiA1          ----------------------------------------------------------------------
1wwhA1          ----------------------------------------------------------------------
1u2fA           ----------------------------------------------------------------------
1ytyA2          ----------------------------------------------------------------------
2dgxA1          ----------------------------------------------------------------------
1x5pA1          ----------------------------------------------------------------------
2cpyA1          ----------------------------------------------------------------------
1sjrA           ----------------------------------------------------------------------
1x5oA1          ----------------------------------------------------------------------
2ditA1          ----------------------------------------------------------------------
1whyA           ----------------------------------------------------------------------
1fjcA           ----------------------------------------------------------------------
1sjqA           ----------------------------------------------------------------------
1x4aA1          ----------------------------------------------------------------------
1wexA           ----------------------------------------------------------------------
2aymA1          ----------------------------------------------------------------------
1wf0A           ----------------------------------------------------------------------
1whxA           ----------------------------------------------------------------------
1x4gA1          ----------------------------------------------------------------------
1wg1A           ----------------------------------------------------------------------
1owxA           ----------------------------------------------------------------------
1weyA           ----------------------------------------------------------------------
1wezA           ----------------------------------------------------------------------
2ghpA3          ----------------------------------------------------------------------
1wf1A           ----------------------------------------------------------------------
2cq2A1          ----------------------------------------------------------------------
2cphA1          ----------------------------------------------------------------------
2cqhA1          ----------------------------------------------------------------------
2id0A3          ----------------------------------------------------------------------
1ufwA           ----------------------------------------------------------------------
1whvA           ----------------------------------------------------------------------
1xdoA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxGGQTWTDSTLLEWDPAHFRLFCGNLAGEVTDDSLLKAFSKYP
1cvjA1          -----------------------------------------------LYVGDLHPDVTEAMLYEKFSPAG
1jmtA           ------------------------------------------LNIYRNPQDGLRSAVSDVEMQEHYDKYG
1u6fA1          ----------------------------------------------NLMVNYIPTTVDEVQLRQLFERYG
1h2vZ           ---------------------------------------KLLKKSCTLYVGNLSFYTTEEQIYELFSKSG
2cq0A1          -----------------------------------------ADDNATIRVTNLSEDTRETDLQELFRPFG
1o0pA           ----------------------------------------------VLCLMNMVEELLDDEVRDECSKYG
1oo0B           -----------------------------------------SVEGWILFVTSIHEEAQEDEIQEKFCDYG
1hl6A           -----------------------------------------SVEGWILFVTSIHEEAQEDEIQEKFCDYG
1cvjF2          ------------------------------------------PSLRKSGVGNI-----NKALYDTFSAFG
1no8A           ----------------------------------------------KLLVSNLDFGVSDADIQELFAEFG
2f9dA1          -----------------------------------------PEVNRILYIRNLPYKITAEEMYDIFGKYG
1x4fA1          ---------------------------------------QKQELGRVIHLSNLPHSGYSDSAVLKAEPYG
1wi8A           -----------------------------------------KSPPYTAFLGNLPYDVTEESIKEFFRGLN
2cpfA1          -----------------------------------------------LFIKNLNFSTTEETLKGVFSKVG
2cqpA1          ------------------------------------------PGPTIIKVQNMPFTVSIDEILDFFYGYQ
1qm9A1          ----------------------------------------------VLLVSNLNPEVTPQSLFILFGVYG
1h2tZ           ---------------------------------------KLLKKSCTLYVGNLSFYTTEEQIYELFSKSG
2cq4A1          -----------------------------------------ERDARTVFCMQLAARIRPRDLEDFFSAVG
2ghpA2          ----------------------------------------------TVLVKNLPKSYNQNKVYKYFKHCG
2cpzA1          -----------------------------------------GPEGANLFIYHLPQEFGDQDLLQMFMPFG
2cpxA1          -----------------------------------------GEPNKVLYLKNLSPRVTERDLVSLFARFQ
2cpdA1          -----------------------------------------MSSVKILYVRNLMLSTSEEMIEKEFNNIK
1b7fA1          -------------------------------------------SNTNLIVNYLPQDMTDRELYALFRAIG
1uw4A           ---------------------------------------------SKVVIRRLPPTLTKEQLQEHLQPMP
3begB1          ----------------------------------------------RVVVSGLPPSGSWQDLKDHMREA-
1a9nB           ----------------------------------------------TIYINNMNDKIKKEELKRSLYALS
1x4eA1          -----------------------------------------------LYIRGLQPGTTDQDLVKLCQPYG
1welA1          -----------------------------------------HEAGFCVYLKGLPFEAENKHVIDFFKKLD
1u1kA           -----------------------------------------PEQLRKLFIGGLSFETTDESLRSHFEQWG
2disA1          ----------------------------------------------RLFIGGIPKMKKREEILEEIAKVT
2ghpA1          ----------------------------------------------TLWXTNFPPSYTQRNIRDLLQDIN
1x4hA1          -----------------------------------------VTEGKTVFIRNLSFDSEEEALGEVLQQFG
1p1tA           -----------------------------------------DRSLRSVFVGNIPYEATEEQLKDIFSEVG
1fj7A           ----------------------------GSHMLEDPVEGSESTTPFNLFIGNLNPNKSVAELKVAISEL-
2cpeA1          ---------------------------------------DEDSDNSAIYVQGLNDSVTLDDLADFFKQCG
1qm9A2          ----------------------------------------------TLHLSNIPPSVSEEDLKVLFSSN-
2cpiA1          -----------------------------------------VVQKNLVFVVGLSQRLADPEVLKRPEYFG
1wwhA1          ----------------------------------------------WVTVFGFPQASASY-ILLQFAQYG
1u2fA           ----------------------------------------------RLYVGNIPFGITEEAMMDFFNAQM
1ytyA2          -----------------------------------------DVKNRSVYIKGFPTDATLDDIKEWLEDKG
2dgxA1          ---------------------------------------------------RLSRKELQQLLQEAFARHG
1x5pA1          -----------------------------------------PRKGNTLYVYGE--DMTPTLLRGAFSPFG
2cpyA1          ---------------------------------------DVNSAKVCAHITNIPFSITKMDVLQFLEGIP
1sjrA           -----------------------------------------QSPVLRIIVENLFYPVTLDVLHQIFSKFG
1x5oA1          -----------------------------------------EQDPTNLYISNLPLSMDEQELENMLKPFG
2ditA1          ----------------------------------RVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKF-
1whyA           -----------------------------------------ANPTTRLWVGGLGPNTSLAALAREFDRF-
1fjcA           ----------------------------------DPCTSKKVRAARTLLAKNLSFNITEDELKEVFEDAL
1sjqA           ----------------------------------------------VIHIRKLPIDVTEGEVISLGLPFG
1x4aA1          -----------------------------------------GNNDCRIYVGNLPPDIRTKDIEDVFYKY-
1wexA           ---------------------------------------------------GLCESVVEADLVEALEKFG
2aymA1          -----------------------------------------QPPNQILFLTNLPEETNEMMLSMLFNQFP
1wf0A           -----------------------------------------------VFVGRCTGDMTEDELREFFSQYG
1whxA           -----------------------------------------GRSKTVILAKNLPAGTLAAEIQETFSRF-
1x4gA1          ---------------------------------------QSSPKNCTVYCGGIASGLTDQLMRQTFSPF-
1wg1A           -----------------------------------------SSGSSGILVKNLPQDSNCQEVHDLLKDY-
1owxA           ---------------------------------------EEKIGCLLKFSGDLDDQTCREDLHILFSNHG
1weyA           ----------------------------------------------GLIACVANESETRAKFESLFRTY-
1wezA           -----------------------------GSSGSSGSSFQ-STTGHCVHMRGLPYRATENDIYNFFSPLN
2ghpA3          --------------------------------------------GREIXIRNLSTELLDENLLREFEGFG
1wf1A           -----------------------------------------KSINSRVFIGNLNTALVKKSDVETIFSKY
2cq2A1          --------------------------------------------------GGLGNGVSRNQLLPVLEKCG
2cphA1          -----------------------------------------KQTTSKILVRNIPFQANQREIRELFSTFG
2cqhA1          ----------------------------------------------KLYIGNLSPAVTADDLRQLFGDR-
2id0A3          -------------------------------------------------------------PLLAQLKQQ
1ufwA           ----------------------------------DATVVVNLQSP-TLEEKNEFPEDLRTELMQTLGSYG
1whvA           -----------------------------------------QPKRDHVLHVTFPKEWKTSDLYQLFSAFG
1xdoA2          ------------------------------------TPILINPDTLVQFLKDLAVEIIRDTIRYALLEIP


                         +         .         .         .         .         *         .:210
query           SVQKARVIRDKRTEKSKGYGFVSFSDGEDYFRAAREMQGKYIGSHPVLLRRAMTEIRPxxxxxxxxxxxx
1cvjA1          PILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTMNFDVIKGKPVRIMWS------------------
1jmtA           EVEE-MNVCDNLGDHLVGNVYVKFRREEDAEKAVIDLNNRWFNGQPIHAELS------------------
1u6fA1          PIESVKIVCDRETRQSRGYGFVKFQSGSSAQQAIAGLNGFNILNKRLKVALA------------------
1h2vZ           DIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWD------------------
2cq0A1          SISRIYLAKDKTTGQSKGFAFISFHRREDAARAIAGVSGFGYDHLILNVEWA------------------
1o0pA           LVKSIEIPRPGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYC------------------
1oo0B           EIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWC------------------
1hl6A           EIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWC------------------
1cvjF2          NILSCKVVC------SKGYGFVHFETQEV-----------------------------------------
1no8A           TLKKAA-VHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTS----------------
2f9dA1          PIRQIRVGNTPETRGTAYVVYEDIFDAK---NACDHLSGFNVCNRYLVVLYY------------------
1x4fA1          ---KIKNYILMRMKSQAFIEMETREDAMA-MVDHCLKKALWFQGRCVKVDLS------------------
1wi8A           ISAVRLPREPSNPERLKGFGYAEFED-LDSLLSALSLNEESLGNKRIRVDVA------------------
2cpfA1          AIKSCTISKKAGVLLSMGFGFVEYKKPEQAQKALKQLQGHTVDGHKLEVRIS------------------
2cqpA1          VIPGSVCLKYNEKGMPTGEAMVAFESRDEATAAVIDLNDRPIGSRKVKLVLG------------------
1qm9A1          -----DVQRVKILFNKKENALVQMADGNQAQLAMSHLNGHKLHGKPIRITLSKHQNVQ------------
1h2tZ           DIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGF---------------
2cq4A1          KVRDVRIISDRNSRRSKGIAYVEFCEIQSV-PLAIGLTGQRLLGVPIIVQAS------------------
2ghpA2          PIIHVDVADSLKKN--FRFARIEFARYDG-ALAAITKTHKVVGQNEIIVSHL------------------
2cpzA1          NVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLK------------------
2cpxA1          EKKGPPIQFRMMTGRMRGQAFITFPNKEIAWQALHLVNGYKLYGKILVIEFG------------------
2cpdA1          P------GAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTLA------------------
1b7fA1          PINTCRIMRDYKTGYSYGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYA------------------
1uw4A           EHDYFEFFSNDTYPHMYARAYINFKNQEDIILFRDRFDGYVFLDNKGQEYPA------------------
3begB1          ------GDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYI------------------
1a9nB           QFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYA------------------
1x4eA1          KIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKASGVQAQMA-----------------------
1welA1          IVEDSIYIAYGPNGKATGEGFVEFRNEAD-YKAALCRHKQYMGNRFIQVHPI------------------
1u1kA           TLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSRE---------------
2disA1          EGVLDVIVSAADKMKNRGFAFVEYESHRAAAMARRKLMPGRLWGHQIAVDWA------------------
2ghpA1          VVAL-------SIRLPRRFAYIDVTSKEDARYCVEKLNGLKIEGYTLVTKVS------------------
1x4hA1          DLKYVRVVLHPDTEHSKGCAFAQFMTQEAAQKC-------------------------------------
1p1tA           PVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNA------------------
1fj7A           FAKNDLAVVDVRTGTNRKFGYVDFESAEDL-EKALELTGLKVFGNEIKLEKP------------------
2cpeA1          VVKMNKRTGQPMIHKPKGDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLA------------------
1qm9A2          ---GGVVKGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGNHHLRVSFSKSTI--------------
2cpiA1          KFGKIHKVVINNSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTL-----------------------
1wwhA1          N------ILKHVMSNTGNWMHIRYQSKLQ-ARKALSKDGRIFGESIMI----------------------
1u2fA           RLGGLTPVLAVQINQDKNFAFLEFRSVDE-TTQAMAFDGIIFQGQSLKIRRP------------------
1ytyA2          QVLNIQXRR-TLHKAFKGSIFVVFDSIESAKKFVETPGQK-YKETDLLILFK------------------
2dgxA1          KVKSVELSPHT---DYQLKAVVQMENLQDAIGAVNSLHRYKIGSKKILVSLA------------------
1x5pA1          N------IIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIA------------------
2cpyA1          VDENAVHVLVDNNGQGLGQALVQFKNEDD-ARKSERLHRKKLNGREAFVHVV------------------
1sjrA           TVL----KIITFTKNNQFQALLQYADPVSAQHAKLSLDGQNIYNACCTLRID------------------
1x5oA1          QVISTR-ILRDSSGTSRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPT------------------
2ditA1          ---GQIRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAW------------------
1whyA           -----GSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKSGP------------
1fjcA           -----EIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYT------------------
1sjqA           KVTNLLMLKGKN------QAFIEMNTEEAANTMVNYYTSVVLRGQPIYIQFS------------------
1x4aA1          --GAIRDIDLKNRRGGPPFAFVEFEDPRDAEDA-------------------------------------
1wexA           TICYVMMMPFKRQ---ALVEFENIDS-AKECVTFAADVPVYIAGQQAFFNYS------------------
2aymA1          GFKEVRLVPNRHDIAFVEFTTE-----LQSNAAKEALQGFKIPTHAMKITFA------------------
1wf0A           DVMDVFI-----PKPFRAFAFVTFADDQIAQSLC--GEDLIIKGISVHISNA------------------
1whxA           -----GSLGRVLLPEGGITAIVEFLEPLEARKAFRHLAYSKFHHVPLYLEWA------------------
1x4gA1          -----GQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWG------------------
1wg1A           ------DLKYCYVDRNKRTAFVTLLNGEQAQNAIQMFHQYSFRGKDLIVQLQPTD---------------
1owxA           EIKWIDFVRG------AKEGIILFKEAKEALGKAKNNGNLQLRNKEVTWEVL------------------
1weyA           -----DKDTTFQYFKSFKRVRINFSNPLSAADARLRLHKTEFLGKEMKLYFA------------------
1wezA           PM--RVHIEIGPDGRVTGEADVEFATHEDA-VAAMAKDKANMQHRYVELF--------------------
2ghpA3          SIEKINIPAG--QKFNNCCAFXVFENKDS-AERALQXNRSLLGNREISVSLA------------------
1wf1A           -------GRVAGCSVHKGYAFVQYSNERHARAAVLGENGRVLAGQTLDINMA------------------
2cq2A1          LVDALLMPPNK------PYSFARYRTTEESKRAYVTLNGKEVV---------------------------
2cphA1          ELKTVRLPKKMTGGAHRGFGFVDFITKQDAKKAFNALHSTHLYGRRLVLEWA------------------
2cqhA1          -----KLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVLHGKIMEVDYS------------------
2id0A3          LHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQXKK-------------------------------
1ufwA           --------TIVLVRINQGQMLVTFADSHS-ALSVLDVDGMKVKGRAVKISGP------------------
1whvA           NIQISWIDDT--------SAFVSLSQPEQVQIAVNTSKYA------------------------------
1xdoA2          SDKVPRFVNLPPEAPRRRKPMILLDN--------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1cvjA1          ------------------------------------------
1jmtA           ------------------------------------------
1u6fA1          ------------------------------------------
1h2vZ           ------------------------------------------
2cq0A1          ------------------------------------------
1o0pA           ------------------------------------------
1oo0B           ------------------------------------------
1hl6A           ------------------------------------------
1cvjF2          ------------------------------------------
1no8A           ------------------------------------------
2f9dA1          ------------------------------------------
1x4fA1          ------------------------------------------
1wi8A           ------------------------------------------
2cpfA1          ------------------------------------------
2cqpA1          ------------------------------------------
1qm9A1          ------------------------------------------
1h2tZ           ------------------------------------------
2cq4A1          ------------------------------------------
2ghpA2          ------------------------------------------
2cpzA1          ------------------------------------------
2cpxA1          ------------------------------------------
2cpdA1          ------------------------------------------
1b7fA1          ------------------------------------------
1uw4A           ------------------------------------------
3begB1          ------------------------------------------
1a9nB           ------------------------------------------
1x4eA1          ------------------------------------------
1welA1          ------------------------------------------
1u1kA           ------------------------------------------
2disA1          ------------------------------------------
2ghpA1          ------------------------------------------
1x4hA1          ------------------------------------------
1p1tA           ------------------------------------------
1fj7A           ------------------------------------------
2cpeA1          ------------------------------------------
1qm9A2          ------------------------------------------
2cpiA1          ------------------------------------------
1wwhA1          ------------------------------------------
1u2fA           ------------------------------------------
1ytyA2          ------------------------------------------
2dgxA1          ------------------------------------------
1x5pA1          ------------------------------------------
2cpyA1          ------------------------------------------
1sjrA           ------------------------------------------
1x5oA1          ------------------------------------------
2ditA1          ------------------------------------------
1whyA           ------------------------------------------
1fjcA           ------------------------------------------
1sjqA           ------------------------------------------
1x4aA1          ------------------------------------------
1wexA           ------------------------------------------
2aymA1          ------------------------------------------
1wf0A           ------------------------------------------
1whxA           ------------------------------------------
1x4gA1          ------------------------------------------
1wg1A           ------------------------------------------
1owxA           ------------------------------------------
1weyA           ------------------------------------------
1wezA           ------------------------------------------
2ghpA3          ------------------------------------------
1wf1A           ------------------------------------------
2cq2A1          ------------------------------------------
2cphA1          ------------------------------------------
2cqhA1          ------------------------------------------
2id0A3          ------------------------------------------
1ufwA           ------------------------------------------
1whvA           ------------------------------------------
1xdoA2          ------------------------------------------