[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_01234

[Show Plain Result]

#ERROR : Can't open dsspfile "2iuwA1.bssp"
#ERROR : Can't open dsspfile "2fd8A1.bssp"

## Summary of PDB Search
:388
    7e-15  26%  2iuwA1 [b.82.2.10] ALKYLATED REPAIR PROTEIN ALKB HOMOLOG 3 A:70 --
    4e-13  26%  2fd8A1 [b.82.2.10] ALKYLATED DNA REPAIR PROTEIN ALKB A:15 -- 214
:388

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2iuwA1          ----------------------------------------------------------------------
2fd8A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2iuwA1          ----------------------------------------------------------------------
2fd8A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDDPTRTFSPKDATVHRPLSIQAAL
2iuwA1          ----------------------------------------------------------------------
2fd8A1          ---------------------------------------------DVASQSPFRQMVTPGGYTMSVAMTN


                         .         .         .         +         .         .         .:280
query           NSKLRWITLGGQYNWTTKEYPPGPPPAFPSDISTLLHSIFPETTAEAAIVNLYSPGDTLNPHRDVSEECD
2iuwA1          -QQPRLTAWYGELPYTYSRITMEPNPHWHPVLRTLKNRINTGHTFNSLXCNLYRNEDSVDWHSDDEPSLG
2fd8A1          CGHLGWTTHRQGYLYSPIDPQTNKPPAMPQSFHNLCQRAYPDFQPDACLINRYAPGAKLSLHQDKDEPDL


                         .         *         .         .         .         .         +:350
query           TGLISISLGCHALFLVGHGNGDSCAVIRLRSGDAVYMTGASRFAWHAVPKIIPSTCPxxxxxxxxxxxxx
2iuwA1          RCIASLSFGATRTFEMRKKPPYVERVIPLDHGTLLIMEGATQADWHRVPKEYHSREP-------------
2fd8A1          RAPISVSLGLPAIFQFGGKRNDPLKRLLLEHGDVVVWGGESRLFYHGIQPL-------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2iuwA1          --------------------------------------
2fd8A1          --------------------------------------