[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_01277

[Show Plain Result]

#ERROR : Can't open dsspfile "2furA1.bssp"
#ERROR : Can't open dsspfile "1w3oA1.bssp"
#ERROR : Can't open dsspfile "2fg9A1.bssp"
#ERROR : Can't open dsspfile "1rfeA.bssp"
#ERROR : Can't open dsspfile "1w9aA.bssp"
#ERROR : Can't open dsspfile "2asfA1.bssp"
#ERROR : Can't open dsspfile "2htiA1.bssp"
#ERROR : Can't open dsspfile "1flmA.bssp"
#ERROR : Can't open dsspfile "2hq7A1.bssp"

## Summary of PDB Search
:266
    1e-40  27%  2furA1 [b.45.1.1] HYPOTHETICAL PROTEIN A:16 -- 208
    2e-28  21%  1w3oA1 [b.45.1.1] NIMA-RELATED PROTEIN A:2 -- 195
    9e-16  23%  2fg9A1 [b.45.1.1] 5-NITROIMIDAZOLE ANTIBIOTIC RESISTANCE PROTEIN
    7e-07  11%  1rfeA  [b.45.1.1] HYPOTHETICAL PROTEIN RV2991
    4e-05  14%  1w9aA  [b.45.1.1] HYPOTHETICAL PROTEIN RV1155
    4e-05   9%  2asfA1 [b.45.1.1] HYPOTHETICAL PROTEIN RV2074 A:11 -- 135
    3e-04  17%  2htiA1 [b.45.1.1] BH0577 PROTEIN A:10 -- 165
    6e-04  13%  1flmA  [b.45.1.1] PROTEIN (FMN-BINDING PROTEIN)
    7e-04  13%  2hq7A1 [b.45.1.1] PROTEIN, RELATED TO GENERAL STRESS PROTEIN A:2 --
:266

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxYPKRESNTMNRYKHRGTYDLGPIHSIINSAPVLHVXXXXXXXXXXXAILPMIGQMGSFEYPSSG
2furA1          --------------------RASYSDEDLVAXLDRNFTCTVSFIDGGI-------PYA-------IPXXL
1w3oA1          ------YDPRERDPSVSRRPQNRQSDEWIRELLLRGTIARVATLWQGEDG--AAFPFITPLAYAYRPEQG
2fg9A1          ----------------------------IESIILQADACFVGITDLEGNPY--VVPX-----NFGY----
1rfeA           ----------------------------------------------------------------------
1w9aA           ----------------------------------------------------------------------
2asfA1          ----------------------------------------------------------------------
2htiA1          ----------------------------------------------------------------------
1flmA           ----------------------------------------------------------------------
2hq7A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           IDDPLECYLHGYVSSRIMNLARATDGKGLPICIAATHVDGLILTLTPNSHSYNYRSAVLHGYATLVTDVE
2furA1          ASEGKTIYLHGSXKSRIYGILKT----GQLIAISLLEINGIVLAKEIKNNSINYVSALIFGRPYEIDDTE
1w3oA1          -----DLVYHTNVVGRLRANAG----QGHPATLEVSEIGQFLPSNSPLELSVQYRSVMVFGTARVLAG-E
2fg9A1          ENDTL--YLHSGPEGGKIEXLQ----RNNNVCITFSLGHKLVYQ--HCSYSXRSESAXCRGKVEFIEDXE
1rfeA           ----------GQPHLTAXWYAV--IDGEIWLETKAKKAVNLRFLLEDGDTYDTLRGVSFEGVAEIVEEPE
1w9aA           ----------GRPQLSNVQYHFDPRKLLIQVSIAEPRAKTRNLRRDPRDADDGWSYAVAEGTAQLTPPAA
2asfA1          ----------NSPHVVAVGFTFDPKTHIARVITTGGSQKAVNADRSGLAVVDGARWLSLEGRAAVNSDID
2htiA1          ----------DQPYVIPLNFVW--HNHAIYFHGASEGRKIKXIEANPECEDLAYXSVIIFGTIEPVSAIE
1flmA           -----------HLVNTWNSYLKVLDGNRIVVPVGGMRVLMTLGSRKVAGRNGPGTGFLIRGSAAFRTDGP
2hq7A1          ----------GYPNIKAXXRLKHDGLKKFWLSTNTSTRXVERLKKNNKVDDNKFAGLXLVGTIEILHDRA


                         +         .         .         .         .         *         .:210
query           EKLWAMKLITNSVVPQRWENTRIPPDGAEMQSTTILKVKIVDGSGKIRDGGVSDERKDKDRPDVTEKVWT
2furA1          KKIEVFRLLTEKLVKGRWDNSI-KPSYEDLNGVFVFAVKPETFSXKARTGPPHDTSTD--------DIWS
1w3oA1          DARAALTTLSERVFPGLGETTR-PISEDDLKRTSVYSLSIDRWSGKENWAEQAIQEED----------WP
2fg9A1          EKRHALDIIXRHYTKDQFSYSD-----PAVRNVKVWKVPVDQXTGKVFGL--------------------
1rfeA           ALHRVGVSVWERYTGPYTDEXKPXVDQ-XXNKRVGVRIVARRTRSW--DHR-KLGLPHXSVGGST-----
1w9aA           APDDALIALYRNIAGEHSDWDD-YRQAXVTDRRVLLTLPISHVYGL--PPG-------------------
2asfA1          AVRDAELRY-------------------------------------------------------------
2htiA1          EGTEAXQQXLDKYVPSLGSR------------TAIYKISCRERTAKVN----------------------
1flmA           EFIARFKWARAALVITV-----------------------------------------------------
2hq7A1          SKEXLWTDGC----------EIYYPLGIDDPDYTALCFTAYRHLKNITF---------------------


                         .         .         .         +         .         .         .:280
query           GVVPVWQTFGEPVPDGLNKVNEVPEHISSYxxxxxxxxxxxxxxxxxxxxxxxxxx
2furA1          GVLPIQHTISEA-------GENAPEYVKSL--------------------------
1w3oA1          ALGPEW--------------------------------------------------
2fg9A1          --------------------------------------------------------
1rfeA           --------------------------------------------------------
1w9aA           --------------------------------------------------------
2asfA1          --------------------------------------------------------
2htiA1          --------------------------------------------------------
1flmA           --------------------------------------------------------
2hq7A1          --------------------------------------------------------