[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_01629

[Show Plain Result]

#ERROR : Can't open dsspfile "1z2cB1.bssp"

## Summary of PDB Search
:694
    2e-09  19%  1z2cB1 [a.118.1.23] DIAPHANOUS PROTEIN HOMOLOG 1 B:83 -- 443
:694

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1z2cB1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1z2cB1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1z2cB1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1z2cB1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPTDFVHYLKEVQKPEIVEVSKLHKLRILLRN
1z2cB1          ---------------------------------------AMMYIQELRSGLRDMHL-LSCLESLRVSLNN


                         .         .         .         .         *         .         .:420
query           ETISWVESFISHGGMEQLVDLLYRILKVEWRXXXXXXXXXXXXXCIKALCTTSPALHQLCKIGDDLFPTL
1z2cB1          NPVSWVQTFGAEGLAS-LLDILKRL-----HDEKDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGI-LLL


                         .         .         +         .         .         .         .:490
query           LRMLFGEEKKGPSEFATRNXXXXXXXXXXXXATFEEVATRARTILSYMHDPKPPKESAPLPFIAEMHQAR
1z2cB1          VRAMDPAVPN-------------------------MMIDAAKLLSALCILPQP-----------------


                         *         .         .         .         .         +         .:560
query           PYQLWCKEMSNVTKEVFWIFLHHFNVVPVAKAEDSSLPFIQRYFXXXXXXXXXXXYIGGVEWDATNYLAT
1z2cB1          ----------EDMNERVLEAMTE------RAEMDEVERFQP-----------LLDGLKSGTSI--ALKVG


                         .         .         .         *         .         .         .:630
query           HLDLINGLLASLPTIEERNELRTHLRASGLEKVMGRSLRTCKEKLYPAVHEALKVWVSAAADDEWDxxxx
1z2cB1          CLQLINALITP----AEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFD----


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1z2cB1          ----------------------------------------------------------------