[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_01668

[Show Plain Result]

#ERROR : Can't open dsspfile "1agmA.bssp"
#ERROR : Can't open dsspfile "1ayxA.bssp"
#ERROR : Can't open dsspfile "1a47A2.bssp"
#ERROR : Can't open dsspfile "1lf6A1.bssp"
#ERROR : Can't open dsspfile "1h54A1.bssp"
#ERROR : Can't open dsspfile "2nvpA1.bssp"

## Summary of PDB Search
:628
    2e-73  62%  1agmA  [a.102.1.1] GLUCOAMYLASE-471
    3e-46  33%  1ayxA  [a.102.1.1] GLUCOAMYLASE
    3e-25  30%  1a47A2 [b.3.1.1] CYCLODEXTRIN GLYCOSYLTRANSFERASE A:579 -- 683
    8e-21  15%  1lf6A1 [a.102.1.5] GLUCOAMYLASE A:288 -- 684
    3e-19  11%  1h54A1 [a.102.1.4] MALTOSE PHOSPHORYLASE A:269 -- 753
    1e-13  12%  2nvpA1 [a.102.1.8] HYPOTHETICAL PROTEIN A:2 -- 427
:628

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxALQSILDNIGDDGAKVQGAHAGIVVA
1agmA           --------------------------------------------ARTAILNNIGADGAWVSGADSGIVVA
1ayxA           ---------------------------------------------LYYLLQNIAYPEGQFNNGVPGTVIA
1a47A2          ----------------------------------------------------------------------
1lf6A1          -------------------------------------------------SEDKTNKGAYIASLSIPWGDG
1h54A1          -------------------------------------------------------------DARLNIGPK
2nvpA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SPSRADPDYFYTWTRDAALVFKHLIDAFVAGNHDSQDRIHEYITAQSYLQTVSNPSGTLSTGGLGEPKFH
1agmA           SPSTDNPDYFYTWTRDSGLVIKTLVDLFRNGDTDLLSTIEHYISSQAIIQGVSNPSGDLSSGGLGEPKFN
1ayxA           SPSTSNPDYYYQWTRDSAITFLTVLSELEDNNTTLAKAVEYYINTSYNLQRTSNPSGSFDDEGLGEPKFN
1a47A2          ----------------------------------------------------------------------
1lf6A1          QRDDNTGGYHLVWSRDLYHVANAFIAA------GDVDSANRSLDYLAKVV---------KDNGMIPQNTW
1h54A1          GFTGEKYGGATYWDTEAFAFPVYLGITDPKVTRNLLMYRYKQLDGAYINAQEQGLKGAL----FPMVTFD
2nvpA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           VDQSAFTGSWGRPQADGPALRATAMITYAKWLIANGHEDAAKSIVWPVVQNDLSYVGQFWNSTGFDLWEE
1agmA           VDETAYTGSWGRPQRDGPALRATAMIGFGQWLLDNGYTSAATEIVWPLVRNDLSYVAQYWNQTGYDLWEE
1ayxA           TDGSAYTGAWGRPQNDGPALRAYAISRYLNDVNSLNEGSSTEDIYKNIIKPDLEYVIGYWDSTGFDLWEE
1a47A2          ----------------------------------------------------------------------
1lf6A1          ISG---KPYWTGIQLDEQADPIILSYRLKRY-----------DLYDSLVKPLADFIIKIGPKTGQERWEE
1h54A1          GIECHNEWEITFEEIHRNGDIAFAIYNYTRY---TGDDSYVLHEGAKVLTEISRFWADRHGVTGADEYEN
2nvpA1          ------------------------------YSFQRLNCSVTDTLSHEGLGTPVTYTGXTWSRPSDDACEY


                         .         .         .         +         .         .         .:280
query           VQGSSFFTAIAQHRALAEGNNLARQLGTDCPHCESQAPQILCFLQSFWTGSNIIANFGGDRSGLDANSLL
1agmA           VNGSSFFTIAVQHRALVEGSAFATAVGSSCSWCDSQAPQILCYLQSFWTGSYILANFDSSRSGKDTNTLL
1ayxA           NQGRHFFTSLVQQKALAYAVDIAKSFDDGDFTLSSTASTLESYLSGSDGGHIVENPDLLQQNSLDSATYI
1a47A2          ----------------------------------------------------------------------
1lf6A1          IGGYSPATMAAEVAGLTCAAYIAEQNKDYESKYQEKADNWQKLIDNLTYTYYIRIAGLSDPDADFMINIA
1h54A1          NVDNNWDTNMLAQWTLKYTLEILGKVDQDTAVSDEEKTKWQDIVDRMYLPYDKDLNIFVQHDG----FLD
2nvpA1          GYLIPANXFAV--VALRYISEIAEKVYKDEEKADSLREEIDAIEKHGKVYK---EGFGEVY----AYETD


                         .         *         .         .         .         .         +:350
query           GIIHNFDPEADCDDNTFQPCSSRALANHKKVTDSFREIYPINSGMEGDQAVAVGRYAEDVYYGGQPWYLA
1agmA           GSIHTFDPEAGCDDSTFQPCSPRALANHKEVVDSFRSIYTLNDGLSDSEAVAVGRYPEDSYYNGNPWFLC
1ayxA           GPLLTHDIGE-SSSTPFDVDNEYVLQSYYLLLEDNKDRYSVNSAYSA--GAAIGRYPEDVYSEGNPWFLA
1a47A2          ----------------------------------------------------------------------
1lf6A1          NGGGVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDSTIKVDTPKGPSWYRYNHDGYGEPSKTE--
1h54A1          KDIEPVSSIPADQRPINQNWSWDKILRSPYIKQGDQGIWDFIDDYTPEQKKANFDFYEPLTVHESSLSPA
2nvpA1          GXGNYNFXDDANVPSLLSIPYLEYKGIEDEVYQNTRKFILSKNNRFFFEGKAAKGIGSPHTPDQYIWHIA


                         .         .         .         .         *         .         .:420
query           TFASAELLYDAIYQWNHTGKITITDVSLPFFQSIYKSAQVGTYSSSTNVFSEIIANVGSYADGYLNVARK
1agmA           TLAAAEQLYDALYQWDKQGSLEITDVSLDFFKALYSGAATGTYSSSSSTYSSIVSAVKTFADGFVSIVET
1ayxA           TAYAAQVPYKLAYDAKASNDITINKINYDFFNKYIVDLSTITIKSGSDEFNTVADNLVTFGDSFLQVILD
1a47A2          ----------------------------------------------------------------------
1lf6A1          -------------LYHGAGKGRLWPLLT-GERGMYEIAAGK------------------DATPYVKAMEK
1h54A1          IHSVLAADL-------------------------------------------------------------
2nvpA1          LSXQGLTTNN-----------------------------------------------QEEIDQLIKLLKE


                         .         .         +         .         .         .         .:490
query           YTPCSGALAEQFSRNDGTPLSASDLTWSYAALLTAKERRESVVPGSWGQKSAHDVPPTCLATSAAGSYQT
1agmA           HAASNGSLSEQFDKSDGDELSARDLTWSYAALLTANNRRNSVVPPSWGETSASSVPGTCAATSASGTYSS
1ayxA           HINDDGSLNEQLNRYTGYSTGAYSLTWSSGALLEAIRLRNKVKALA------------------------
1a47A2          ----------------------------------------------------------------------
1lf6A1          FANEGGIISEQVWEDTGLPTSASPLNWAHAEYVILFASNIEHKVLDMPDIVY------------------
1h54A1          ----------------------------------------------------------------------
2nvpA1          TDAGTGYXHEGFHVDDPTKFTRDWFAWSNSLFSHFIYE--------------------------------


                         *         .         .         .         .         +         .:560
query           ATxxxxxxxxxxxxxxxxxxxxxxxxSVKITFQSVTDTKWGENIFLVGSIPELGSWEPSAAKQLKADKYE
1agmA           VT--------------------------------------------------------------------
1ayxA           ----------------------------------------------------------------------
1a47A2          --------------------------QICVRFVNNASTVYGENVYLTGNVAELGNWDTSKAIGPMFNQVV
1lf6A1          ----------------------------------------------------------------------
1h54A1          ----------------------------------------------------------------------
2nvpA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           ASCPLWSIQIDLAAGKKFDYRYIRKSDDGRVVWESDPNRSYTVPxxxxxxxxxxxxxxxxxxxxxxxx
1agmA           --------------------------------------------------------------------
1ayxA           --------------------------------------------------------------------
1a47A2          YQYPTWYYDVSVPAGTTIQFKFIKK-NGNTITWEGGSNHTYTVP------------------------
1lf6A1          --------------------------------------------------------------------
1h54A1          --------------------------------------------------------------------
2nvpA1          --------------------------------------------------------------------