[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_01675

[Show Plain Result]

#ERROR : Can't open dsspfile "2cayA1.bssp"
#ERROR : Can't open dsspfile "2dx5A1.bssp"
#ERROR : Can't open dsspfile "1bgxT4.bssp"
#ERROR : Can't open dsspfile "2hthB1.bssp"

## Summary of PDB Search
:270
    4e-09  22%  2cayA1 [b.55.1.12] VACUOLAR PROTEIN SORTING PROTEIN 36 A:1 -- 99
    1e-05  17%  2dx5A1 [b.55.1.12] VACUOLAR PROTEIN SORTING PROTEIN 36 A:10 -- 130
    9e-05  18%  1bgxT4 [e.8.1.1] TAQ DNA POLYMERASE T:423 -- 832
    1e-04  19%  2hthB1 [b.55.1.12] VACUOLAR PROTEIN SORTING PROTEIN 36 B:3 -- 131
:270

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxSWVMLHETDGFVRLPNERLIYTSPLRTTISLQALNPRPGDESLSLQSS
2cayA1          ----------------------HYVETTSSGQPLLREGEKDIYHGKSKILQRQR----------------
2dx5A1          -----------------------------------EINETLVIQ---QRGVRVY----DGEEKFDA----
1bgxT4          ----------------------------------------------------------------------
2hthB1          ------------------------------------------------------------GEEKIKFD--


                         .         .         *         .         .         .         .:140
query           NGRVHLTNQRIVYLPVQPTPQFQSFSAPLLNLHDTFVSAPFFGPNVWSAIVQPVVGGGIPPSNTAVQVKM
2cayA1          -GRIFLTSQRIIYIDDAKPTQN-SLGLELDDLAYVNYSSGFLTRS-PRLILFFK-----DPSSSTEFVQL
2dx5A1          -GTLLLSTHRLIWRD----QKNNECCMAIPLSQIVFIE------EQAKIVVHLHSKNSY--------IRL
1bgxT4          ------------------------------------------------------VLYGMSAHRLSQELAI
2hthB1          AGTLLLSTHRLIW--RDQKNHECCMAILLSQIVFIEEQAAGIGKSAKLHPAPPNKEPGPFQSSKNSYIKL


                         +         .         .         .         .         *         .:210
query           TFKEGGAFDFHSAFERIKERLQQVVEQARENGMISxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cayA1          SFRKSDGVLF---SQATERALENI----------------------------------------------
2dx5A1          SFKEHGQIEFYR---RLSEEMTQ-----------------------------------------------
1bgxT4          PYEEAQAFRYFQSFPKVRAWIEKTLEEGRRRGYVE-----------------------------------
2hthB1          SFKEHGQIEFYRRL--------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2cayA1          ------------------------------------------------------------
2dx5A1          ------------------------------------------------------------
1bgxT4          ------------------------------------------------------------
2hthB1          ------------------------------------------------------------