[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_02126

[Show Plain Result]

#ERROR : Can't open dsspfile "1d5rA2.bssp"
#ERROR : Can't open dsspfile "1u24A.bssp"
#ERROR : Can't open dsspfile "1fpzA.bssp"
#ERROR : Can't open dsspfile "1mkpA.bssp"
#ERROR : Can't open dsspfile "1sf9A.bssp"
#ERROR : Can't open dsspfile "1lyvA.bssp"
#ERROR : Can't open dsspfile "1ohcA2.bssp"
#ERROR : Can't open dsspfile "1rxdA.bssp"
#ERROR : Can't open dsspfile "1yt8A4.bssp"
#ERROR : Can't open dsspfile "1ywfA1.bssp"
#ERROR : Can't open dsspfile "1v7vA1.bssp"

## Summary of PDB Search
:598
    5e-12  14%  1d5rA2 [c.45.1.1] PHOSPHOINOSITIDE PHOSPHOTASE PTEN A:14 -- 187
    6e-10   8%  1u24A  [c.45.1.4] MYO-INOSITOL HEXAPHOSPHATE PHOSPHOHYDROLASE
    1e-08  14%  1fpzA  [c.45.1.1] CYCLIN-DEPENDENT KINASE INHIBITOR 3
    6e-08  27%  1mkpA  [c.45.1.1] PYST1
    4e-07   9%  1sf9A  [b.34.15.1] YFHH HYPOTHETICAL PROTEIN
    1e-06  16%  1lyvA  [c.45.1.2] PROTEIN-TYROSINE PHOSPHATASE YOPH
    2e-06  10%  1ohcA2 [c.45.1.1] CDC14B2 PHOSPHATASE A:199 -- 380
    8e-06  27%  1rxdA  [c.45.1.1] PROTEIN TYROSINE PHOSPHATASE TYPE IVA, MEMBER 1
    1e-04  21%  1yt8A4 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:243 -- 372
    2e-04  10%  1ywfA1 [c.45.1.5] PHOSPHOTYROSINE PROTEIN PHOSPHATASE PTPB A:4 --
    0.001  21%  1v7vA1 [a.102.1.4] CHITOBIOSE PHOSPHORYLASE A:271 -- 801
:598

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1d5rA2          ----------------------------------------------------------------------
1u24A           ----------------------------------------------------------------------
1fpzA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
1sf9A           ----------------------------------------------------------------------
1lyvA           ----------------------------------------------------------------------
1ohcA2          ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
1ywfA1          ----------------------------------------------------------------------
1v7vA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1d5rA2          ----------------------------------------------------------------------
1u24A           ----------------------------------------------------------------------
1fpzA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
1sf9A           ----------------------------------------------------------------------
1lyvA           ----------------------------------------------------------------------
1ohcA2          ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
1ywfA1          ----------------------------------------------------------------------
1v7vA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1d5rA2          ----------------------------------------------------------------------
1u24A           ----------------------------------------------------------------------
1fpzA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
1sf9A           ----------------------------------------------------------------------
1lyvA           ----------------------------------------------------------------------
1ohcA2          ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
1ywfA1          ----------------------------------------------------------------------
1v7vA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxNPFSTDGPKHDTVMSVWKATLAQSNAALRGEDPDTACSELSFK
1d5rA2          ----------------------------------------------------------------------
1u24A           ----------------------------------------------------------------------
1fpzA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
1sf9A           ----------------------------------------------------------------------
1lyvA           ----------------------------------------------------------------------
1ohcA2          ---------------------------NLDEYEHYEKAENGDLNWIIPDRFIAFCGHQHSPETYIQYFKN
1rxdA           ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
1ywfA1          -------------------------------SSELSRLDDAGRATLRRLGITDVADLRSSREVARRGPGR
1v7vA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           SALESLSDECPPTPKANRPEPEYIHVPWDHNSEILDDLFPLCEIIDNRISKGKRVLIHCQLGVSRSASLV
1d5rA2          -----YNLCAERHYDTAKFNCRVAQYPFEDHNPPQLEPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMI
1u24A           -----VQKVQTEQEVAEAAGXRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHCEAGVGRTTAFX
1fpzA           ----------------------HHHPIADGGTPDIASCCEIMEELTTCLKNYRKTLIHSYGGLGRSCLVA
1mkpA           ----NVTPNLPN-LFENAGEFKYKQIPISDHWNLSQFFPEAISFIDEARGKNCGVLVHSLAGISRSVTVT
1sf9A           ----------------------QSNAMEYSQMTPHELNTEIALLSEKARKAEQHGIINELAVLERKITMA
1lyvA           ----------------------ALASLVDQTAETKRNMYESKGSSAVADDSKLRPVIHSRAGVGRTAQLI
1ohcA2          HNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVEFLDICENAEGAIAVHCKAGLGRTGTLI
1rxdA           ---------CEATYDTTLVEKEIHVLDWPFGAQIVDDWLSLVKIKFRE-EPGCCIAVHCVAGLGRAPVLV
1yt8A4          -----------------RTPEEYRSTPGGQLVQETDHVAS---------VRGARLVLVDDDGVANXSASW
1ywfA1          VPDGIDVHLLPFPDLADSINDAATRYMTDEYRQFPTRNGAQRALVVTLLAAGRPVLTHCFAGKDRTGFVV
1v7vA1          -----------------------------GETSFFDQMIPY-------ADGGEASVYHMKAALDFSAEYV


                         .         .         .         .         *         .         .:420
query           IAYGLYKNTHLDFNAVYGMVKERSCWVGPNMSLIYQLTDFRTKIRGxxxxxxxxxxxxxxxxxxxxxxxx
1d5rA2          CAYLLHRGKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSYLLKN------------------------
1u24A           VXT-DXLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDS-----------------------------
1fpzA           ACLLLYLSDTISPEQAIDSLRDLRGSGAIQTIKQYN----------------------------------
1mkpA           VAY-LMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL--------------------------
1sf9A           KAYLLNPEDYSPGETYRVENTEDEF--TISYLNGVFAWGYRTSSP-------------------------
1lyvA           GAMCMNDSRNSQLSVEDMVSQMRVQ---------------------------------------------
1ohcA2          ACYIMKHYRMTAAETIAWVRICRPGSVGPQQQFLVMKQTNLWLEGD------------------------
1rxdA           ALA-------------------------------------------------------------------
1yt8A4          LAQXGWQVAVLD----------------------------------------------------------
1ywfA1          ALVLEAVGLRDVIVADYLRSNDSVPQLRARISEMIQQ---------------------------------
1v7vA1          GQTGICKGLRADWNDCLNLGGGESSMVS------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1d5rA2          ----------------------------------------------------------------------
1u24A           ----------------------------------------------------------------------
1fpzA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
1sf9A           ----------------------------------------------------------------------
1lyvA           ----------------------------------------------------------------------
1ohcA2          ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
1ywfA1          ----------------------------------------------------------------------
1v7vA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1d5rA2          ----------------------------------------------------------------------
1u24A           ----------------------------------------------------------------------
1fpzA           ----------------------------------------------------------------------
1mkpA           ----------------------------------------------------------------------
1sf9A           ----------------------------------------------------------------------
1lyvA           ----------------------------------------------------------------------
1ohcA2          ----------------------------------------------------------------------
1rxdA           ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
1ywfA1          ----------------------------------------------------------------------
1v7vA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1d5rA2          --------------------------------------
1u24A           --------------------------------------
1fpzA           --------------------------------------
1mkpA           --------------------------------------
1sf9A           --------------------------------------
1lyvA           --------------------------------------
1ohcA2          --------------------------------------
1rxdA           --------------------------------------
1yt8A4          --------------------------------------
1ywfA1          --------------------------------------
1v7vA1          --------------------------------------