[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_02186

[Show Plain Result]

#ERROR : Can't open dsspfile "1w1oA2.bssp"
#ERROR : Can't open dsspfile "1mbbA1.bssp"
#ERROR : Can't open dsspfile "1ahuA2.bssp"
#ERROR : Can't open dsspfile "1kuuA.bssp"
#ERROR : Can't open dsspfile "1i19A2.bssp"
#ERROR : Can't open dsspfile "1t3qC2.bssp"
#ERROR : Can't open dsspfile "1fiqB2.bssp"
#ERROR : Can't open dsspfile "1f0xA2.bssp"
#ERROR : Can't open dsspfile "1hskA1.bssp"
#ERROR : Can't open dsspfile "1ffuC2.bssp"
#ERROR : Can't open dsspfile "1jroA4.bssp"
#ERROR : Can't open dsspfile "1h12A.bssp"

## Summary of PDB Search
:567
    4e-22  19%  1w1oA2 [d.145.1.1] CYTOKININ DEHYDROGENASE 1 A:40 -- 245
    9e-21   9%  1mbbA1 [d.145.1.2] URIDINE DIPHOSPHO-N-ACETYLENOLPYRUVYLGLUCOSAMINE
    7e-20  13%  1ahuA2 [d.145.1.1] VANILLYL-ALCOHOL OXIDASE A:6 -- 273
    3e-18  11%  1kuuA  [d.153.2.1] CONSERVED PROTEIN
    4e-18  17%  1i19A2 [d.145.1.1] CHOLESTEROL OXIDASE A:57 -- 273
    6e-17   7%  1t3qC2 [d.145.1.3] QUINOLINE 2-OXIDOREDUCTASE MEDIUM SUBUNIT C:1 --
    5e-15   8%  1fiqB2 [d.145.1.3] XANTHINE OXIDASE B:224 -- 414
    7e-15   9%  1f0xA2 [d.145.1.1] D-LACTATE DEHYDROGENASE A:9 -- 273
    2e-14  16%  1hskA1 [d.145.1.2] UDP-N-ACETYLENOLPYRUVOYLGLUCOSAMINE REDUCTASE
    3e-14  10%  1ffuC2 [d.145.1.3] CUTM, FLAVOPROTEIN OF CARBON MONOXIDE C:1 -- 177
    5e-14  11%  1jroA4 [d.145.1.3] XANTHINE DEHYDROGENASE, CHAIN A A:179 -- 345
    3e-08   8%  1h12A  [a.102.1.2] ENDO-1,4-BETA-XYLANASE
:567

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w1oA2          ----------------------------------------------------------------------
1mbbA1          ----------------------------------------------------------------------
1ahuA2          ----------------------------------------------------------------------
1kuuA           ----------------------------------------------------------------------
1i19A2          ----------------------------------------------------------------------
1t3qC2          ----------------------------------------------------------------------
1fiqB2          ----------------------------------------------------------------------
1f0xA2          ----------------------------------------------------------------------
1hskA1          ----------------------------------------------------------------------
1ffuC2          ----------------------------------------------------------------------
1jroA4          ----------------------------------------------------------------------
1h12A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSPRDAPCDQGIVPHYSVNIQSTSDIQTAVKF
1w1oA2          ------------------------------------------------SALPAAVLYPSSTGDLVALLSA
1mbbA1          ---------------------------------------------------AQHIVCAEDEQQLLNAWQY
1ahuA2          ---------------------------------------DPHHVMDQDYFLASAIVAPRNVADVQSIVGL
1kuuA           ----------------------------------------------------------------------
1i19A2          -----------------------------------------------------------TPQDVVRLANW
1t3qC2          ---------------------------------------------------AFSYRAPASLQEVIQVLAD
1fiqB2          ---------------------------------------------------RVTWIQASTLKELLDLKAQ
1f0xA2          --------------------------------------------------DALAVVFPGSLLELWRVLKA
1hskA1          ---------------------------------------------------ADFYITPTKNEEVQAVVKY
1ffuC2          -----------------------------------------------------------SVGEAVALLGQ
1jroA4          -----------------------------------------------------------TSDALADWYLA
1h12A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWHTSFIPKGAPQETTGIPAVTLQAGEQWLDVY
1w1oA2          ANSWPYTIAFRGRGHSLMGQAFAPGGVVVNMASLGDAAAP------PRINVSADGRYVDAGGEQVWIDVL
1mbbA1          ATAEGQPVLILGEGSNVLFLEDYRGTVIINRIKGIEIHDEPDA------------WYLHVGAGENWHRLV
1ahuA2          ANKFSFPLWPISIGRNSGYGGAAPRVSGSVVLDMGKNMNRVLEVNVEGAY-------CVVEPGVTYHDLH
1kuuA           -----------------LGRILAVGRNSNGSFVAYRVSSRS-------FPNRT----TSIQEERVAVVPV
1i19A2          AHEHDYKIRPRGAMHGWTPLTVEKGANVEKVILADTMTHLNGIVNTGGP-----VATVTAGAGASIEAIV
1t3qC2          D--PDARIIAGGQSLLPLLAFRLVPSCLVDLRNVSELFEIS---------QSAGI--LSVGAMVTHFRNK
1fiqB2          HP--EAKLVVGNTEIGIEMKFKNLFPMIICPAWIPELNAVE-------HGPEG----ISFGAACALSSVE
1f0xA2          CVTADKIILMQAANTGLTEGSTPNGNDYDRDVRLDKLHVL--------GKGEQ----VLAYPGTTLYSLE
1hskA1          AYQNEIPVTYLGNGSNIIIREGGIRGIVISLLSLDHIE--------------VSDDAIIAGSGAAIIDVS
1ffuC2          LGSD---AKLLAGGHSLLPMMKLRFAQPEHLIDINRIPELRGIREEGS--------TVVIGAMTVENDLI
1jroA4          H--PEATLIAGGTDVSLWVTKALDLPEVAFLSHCKDLAQIR-------ETPDG----YGIGAGVTIAALR
1h12A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RAAAENGVIVVGGSARTVXXXXXXXXXXXHSPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYA
1w1oA2          RASLARGVAPRSWTDYLYLTVGGTLSNAGISGQAFRHGPQISNVLEMDVITGHGEMVTCSKQLNADLFDA
1mbbA1          KYTLQEGMPGLENLALIP----GCVGSSPIQNIGAYGVELQRVCAYVDSVELATGKQVRKECRFGYRDSI
1ahuA2          NYLEANNLRDLWLDVPDLGGGSVLGNAVERGVGYTPYGDHWMMHSGMEVVLANGELLRTGMGALPDPKRP
1kuuA           EGHERDVFRNPYIAYNCIRIVGDTAVVSNTIADKVALGMNLRDAIGLSLLAMDYEKDELNTP---RIAAA
1i19A2          TELQKHDVLSIGGALAVNAHGAALPAVGQTTLPGHTYGSLSNLVTELTAVVWNGTTYALETYQRNDPRIT
1t3qC2          TDPTVAKCVPILPKVLAHVAHQAVRNRGTLGADAGAEMPFLMATLGATMYIASSAGVR--SVSATDFMKG
1fiqB2          KTLLEAVAKLPTQKTEVFRGVLEQLRWFAGKQVIITASPISDLNPVFMASGTKLTIVSRGTRMDHTFFPS
1f0xA2          KALKPLGEPHSVIGSSCIGASVIGGICNNSGGSLVQRGPAYTEMSLFARINEDGKLTLVNH-LGIDLGET
1hskA1          RVARDYALTGLEFACGIPGSIGGA-----VYMNAGAYGGEVDCIDYALCVNEQGSLIKLTTKELELDYRN
1ffuC2          SSPIVQARLPLLAEAAKLIADPQVRNRGTIGGDPGNDHPALSIAVEAHFVLEGPNGRRTVPA--DGFFLG
1jroA4          AFAEGPHPALLRRFASEQVRQVATIGGNIANGSPIGDGPPALIAMGASLTLRRGQERRRMPL--EDFFLE
1h12A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LRGGGGSAWGVITSVTYKTHPSPSHIQVGLVQFNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w1oA2          VLGGLGQ-FGVITRARIAVEPA------------------------------------------------
1mbbA1          FKHEYQD-RFAIVAVGLRLPKEWQPVLTYGDLTR------------------------------------
1ahuA2          ETMFSQSNMGIVTKIGIWLMPNP-----------------------------------------------
1kuuA           INGSEAF-IGIVTADGLMVSRVPEETPVYISTY-------------------------------------
1i19A2          PLLTNL-GRCFLTSVTMQAGPN------------------------------------------------
1t3qC2          HYFTDLEAGEVLVRVEIPIPA-------------------------------------------------
1fiqB2          YRKTLLGPEEILLSIEIPYSR-------------------------------------------------
1f0xA2          PEQ-------------------------------------------------------------------
1hskA1          S--IIQKEHLVVLEAAFTLAP-------------------------------------------------
1ffuC2          TYMTLLEENEVMVEIRVPAFAA------------------------------------------------
1jroA4          YRKQDRRPGEFVESVTLP----------------------------------------------------
1h12A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w1oA2          ----------------------------------------------------------------------
1mbbA1          ----------------------------------------------------------------------
1ahuA2          ----------------------------------------------------------------------
1kuuA           ----------------------------------------------------------------------
1i19A2          ----------------------------------------------------------------------
1t3qC2          ----------------------------------------------------------------------
1fiqB2          ----------------------------------------------------------------------
1f0xA2          ----------------------------------------------------------------------
1hskA1          ----------------------------------------------------------------------
1ffuC2          ----------------------------------------------------------------------
1jroA4          ----------------------------------------------------------------------
1h12A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAKRDETSTHPIWEQSRALLSFAANWRDDASAN
1w1oA2          ----------------------------------------------------------------------
1mbbA1          ----------------------------------------------------------------------
1ahuA2          ----------------------------------------------------------------------
1kuuA           ----------------------------------------------------------------------
1i19A2          ----------------------------------------------------------------------
1t3qC2          ----------------------------------------------------------------------
1fiqB2          ----------------------------------------------------------------------
1f0xA2          ----------------------------------------------------------------------
1hskA1          ----------------------------------------------------------------------
1ffuC2          ----------------------------------------------------------------------
1jroA4          ----------------------------------------------------------------------
1h12A           --------------------------------------QWYEFDAWRVIMNVGLDAHLMGAQAWHKSAVN


                         *         .         .         .         .         +         .:560
query           EKRNAKLSLVEISKKLGDIVGPGGGTYVNEANPYEPDWQNVFWGEKYARLLAIKKRIDPTNLFxxxxxxx
1w1oA2          ----------------------------------------------------------------------
1mbbA1          ----------------------------------------------------------------------
1ahuA2          ----------------------------------------------------------------------
1kuuA           ----------------------------------------------------------------------
1i19A2          ----------------------------------------------------------------------
1t3qC2          ----------------------------------------------------------------------
1fiqB2          ----------------------------------------------------------------------
1f0xA2          ----------------------------------------------------------------------
1hskA1          ----------------------------------------------------------------------
1ffuC2          ----------------------------------------------------------------------
1jroA4          ----------------------------------------------------------------------
1h12A           KSYAKTNNSKNCYEQVYSYGGAGEGQKAANAVALLASTNAGQANEFFNEFWSLSQPTGDYRYY-------


                         .         .         .         *         .         .         .:630
query           xxxxxxx
1w1oA2          -------
1mbbA1          -------
1ahuA2          -------
1kuuA           -------
1i19A2          -------
1t3qC2          -------
1fiqB2          -------
1f0xA2          -------
1hskA1          -------
1ffuC2          -------
1jroA4          -------
1h12A           -------