[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_02196

[Show Plain Result]

#ERROR : Can't open dsspfile "1on0A.bssp"
#ERROR : Can't open dsspfile "1yx0A1.bssp"
#ERROR : Can't open dsspfile "1vhsA.bssp"
#ERROR : Can't open dsspfile "2b3uA1.bssp"
#ERROR : Can't open dsspfile "1y9kA1.bssp"
#ERROR : Can't open dsspfile "1vkcA.bssp"
#ERROR : Can't open dsspfile "1yr0A1.bssp"
#ERROR : Can't open dsspfile "1tiqA.bssp"
#ERROR : Can't open dsspfile "1z4eA1.bssp"
#ERROR : Can't open dsspfile "1ro5A.bssp"
#ERROR : Can't open dsspfile "2ae6A1.bssp"
#ERROR : Can't open dsspfile "2a6aA2.bssp"
#ERROR : Can't open dsspfile "1cm0A.bssp"
#ERROR : Can't open dsspfile "1lrzA3.bssp"
#ERROR : Can't open dsspfile "2fl4A1.bssp"
#ERROR : Can't open dsspfile "1mk4A.bssp"
#ERROR : Can't open dsspfile "1bobA.bssp"
#ERROR : Can't open dsspfile "2euiA1.bssp"
#ERROR : Can't open dsspfile "1u6mA.bssp"
#ERROR : Can't open dsspfile "1wwzA1.bssp"
#ERROR : Can't open dsspfile "1s3zA.bssp"
#ERROR : Can't open dsspfile "1yk3A1.bssp"
#ERROR : Can't open dsspfile "1ozpA.bssp"
#ERROR : Can't open dsspfile "2ge3A1.bssp"
#ERROR : Can't open dsspfile "1nslA.bssp"
#ERROR : Can't open dsspfile "2fsrA1.bssp"
#ERROR : Can't open dsspfile "2bswA1.bssp"
#ERROR : Can't open dsspfile "1gheA.bssp"
#ERROR : Can't open dsspfile "2i6cA1.bssp"
#ERROR : Can't open dsspfile "1bo4A.bssp"
#ERROR : Can't open dsspfile "1i12A.bssp"
#ERROR : Can't open dsspfile "1y9wA1.bssp"
#ERROR : Can't open dsspfile "1q2yA.bssp"
#ERROR : Can't open dsspfile "1wk4A.bssp"
#ERROR : Can't open dsspfile "1s7fA1.bssp"
#ERROR : Can't open dsspfile "1yreA1.bssp"
#ERROR : Can't open dsspfile "2fiaA1.bssp"
#ERROR : Can't open dsspfile "1xmtA.bssp"
#ERROR : Can't open dsspfile "1sqhA.bssp"
#ERROR : Can't open dsspfile "2ozgA2.bssp"
#ERROR : Can't open dsspfile "1b6bA.bssp"

## Summary of PDB Search
:209
    8e-10  22%  1on0A  [d.108.1.1] YYCN PROTEIN
    2e-09  24%  1yx0A1 [d.108.1.1] HYPOTHETICAL PROTEIN YSNE A:1 -- 151
    1e-08  14%  1vhsA  [d.108.1.1] SIMILAR TO PHOSPHINOTHRICIN ACETYLTRANSFERASE
    1e-08  12%  2b3uA1 [d.108.1.1] DIAMINE ACETYLTRANSFERASE 1 A:2 -- 170
    2e-08  23%  1y9kA1 [d.108.1.1] IAA ACETYLTRANSFERASE A:1 -- 152
    3e-08  22%  1vkcA  [d.108.1.1] PUTATIVE ACETYL TRANSFERASE
    6e-08  19%  1yr0A1 [d.108.1.1] PHOSPHINOTHRICIN ACETYLTRANSFERASE A:4 -- 166
    8e-08  22%  1tiqA  [d.108.1.1] PROTEASE SYNTHASE AND SPORULATION NEGATIVE
    2e-07  18%  1z4eA1 [d.108.1.1] TRANSCRIPTIONAL REGULATOR A:4 -- 153
    4e-07   9%  1ro5A  [d.108.1.3] AUTOINDUCER SYNTHESIS PROTEIN LASI
    4e-07  16%  2ae6A1 [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY A:1 -- 161
    5e-07  10%  2a6aA2 [c.55.1.9] HYPOTHETICAL PROTEIN TM0874 A:104 -- 193
    6e-07  17%  1cm0A  [d.108.1.1] P300/CBP ASSOCIATING FACTOR
    6e-07   6%  1lrzA3 [d.108.1.4] FACTOR ESSENTIAL FOR EXPRESSION OF METHICILLIN
    8e-07  25%  2fl4A1 [d.108.1.1] SPERMINE/SPERMIDINE ACETYLTRANSFERASE A:1 -- 146
    8e-07  18%  1mk4A  [d.108.1.1] HYPOTHETICAL PROTEIN YQJY
    1e-06  10%  1bobA  [d.108.1.1] HISTONE ACETYLTRANSFERASE
    1e-06  27%  2euiA1 [d.108.1.1] PROBABLE ACETYLTRANSFERASE A:1 -- 153
    2e-06  15%  1u6mA  [d.108.1.1] ACETYLTRANSFERASE, GNAT FAMILY
    3e-06  14%  1wwzA1 [d.108.1.1] HYPOTHETICAL PROTEIN PH1933 A:1 -- 157
    4e-06  18%  1s3zA  [d.108.1.1] AMINOGLYCOSIDE 6'-N-ACETYLTRANSFERASE
    5e-06   7%  1yk3A1 [d.108.1.1] HYPOTHETICAL PROTEIN RV1347C/MT1389 A:10 -- 207
    5e-06  22%  1ozpA  [d.108.1.1] HYPOTHETICAL PROTEIN RV0819
    6e-06  22%  2ge3A1 [d.108.1.1] PROBABLE ACETYLTRANSFERASE A:6 -- 169
    8e-06  10%  1nslA  [d.108.1.1] PROBABLE ACETYLTRANSFERASE
    1e-05   9%  2fsrA1 [d.108.1.1] ACETYLTRANFERASE A:4 -- 167
    1e-05  17%  2bswA1 [d.108.1.1] GLYPHOSATE N-ACETYLTRANSFERASE A:2 -- 146
    2e-05  25%  1gheA  [d.108.1.1] ACETYLTRANSFERASE
    2e-05  20%  2i6cA1 [d.108.1.1] PUTATIVE ACETYLTRANSFERASE A:1001 -- 1160
    3e-05  20%  1bo4A  [d.108.1.1] PROTEIN (SERRATIA MARCESCENS AMINOGLYCOSIDE-3-N-
    4e-05  17%  1i12A  [d.108.1.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    7e-05  26%  1y9wA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 140
    7e-05  24%  1q2yA  [d.108.1.1] SIMILAR TO HYPOTHETICAL PROTEINS
    8e-05  17%  1wk4A  [d.108.1.1] TTK003001606
    9e-05  10%  1s7fA1 [d.108.1.1] ACETYL TRANSFERASE A:1 -- 176
    1e-04  12%  1yreA1 [d.108.1.1] HYPOTHETICAL PROTEIN PA3270 A:11 -- 193
    1e-04  18%  2fiaA1 [d.108.1.1] ACETYLTRANSFERASE A:1 -- 157
    2e-04  21%  1xmtA  [d.108.1.1] PUTATIVE ACETYLTRANSFERASE
    3e-04  19%  1sqhA  [d.108.1.5] HYPOTHETICAL PROTEIN CG14615-PA
    4e-04   8%  2ozgA2 [d.108.1.10] GCN5-RELATED N-ACETYLTRANSFERASE A:8 -- 290
    5e-04  18%  1b6bA  [d.108.1.1] PROTEIN (ARYLALKYLAMINE N-ACETYLTRANSFERASE)
:209

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1on0A           ----------------------------------------------------------------------
1yx0A1          ----------------------------------------------------------------------
1vhsA           ----------------------------------------------------------------------
2b3uA1          ----------------------------------------------------------------------
1y9kA1          ----------------------------------------------------------------------
1vkcA           ----------------------------------------------------------------------
1yr0A1          ----------------------------------------------------------------------
1tiqA           ----------------------------------------------------------------------
1z4eA1          ----------------------------------------------------------------------
1ro5A           ----------------------------------------------------------------------
2ae6A1          ----------------------------------------------------------------------
2a6aA2          ----------------------------------------------------------------------
1cm0A           ----------------------------------------------------------------------
1lrzA3          ----------------------------------------------------------------------
2fl4A1          ----------------------------------------------------------------------
1mk4A           ----------------------------------------------------------------------
1bobA           ----------------------------------------------------------------------
2euiA1          ----------------------------------------------------------------------
1u6mA           ----------------------------------------------------------------------
1wwzA1          ----------------------------------------------------------------------
1s3zA           ----------------------------------------------------------------------
1yk3A1          ----------------------------------------------------------------------
1ozpA           ----------------------------------------------------------------------
2ge3A1          ----------------------------------------------------------------------
1nslA           ----------------------------------------------------------------------
2fsrA1          ----------------------------------------------------------------------
2bswA1          ----------------------------------------------------------------------
1gheA           ----------------------------------------------------------------------
2i6cA1          ----------------------------------------------------------------------
1bo4A           ----------------------------------------------------------------------
1i12A           ----------------------------------------------------------------------
1y9wA1          ----------------------------------------------------------------------
1q2yA           ----------------------------------------------------------------------
1wk4A           ----------------------------------------------------------------------
1s7fA1          ----------------------------------------------------------------------
1yreA1          ----------------------------------------------------------------------
2fiaA1          ----------------------------------------------------------------------
1xmtA           ----------------------------------------------------------------------
1sqhA           ----------------------------------------------------------------------
2ozgA2          ----------------------------------------------------------------------
1b6bA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxEILLAIQNNSTSDNFYEPVHAEESHGGSVSPRKNYCCSCTYVESDVLGCAAL
1on0A           ---------------------------------------------------HHLWSLKLNEKDIVGWLWI
1yx0A1          --------------------------------------PESIHALGLEKLRGPEITFWSAWEGLAGCGAL
1vhsA           ---------------------------------------------------RPLYVAEDENGNVAAWISF
2b3uA1          --------------------------------DLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAXY
1y9kA1          -------------------------------------------------------GLTYVGGSVIGVYVL
1vkcA           ---------------------------------YEERH-EELFESLLSQGEHKFFVALNERSELLGHVWI
1yr0A1          -------------------------------------------------SRGFPVIVAILDGKVAGYASY
1tiqA           ----------------------------------------------------------YFDHEIAGYVKV
1z4eA1          -------------------------------------------------DKNNELIVACNGEEIVGMLQV
1ro5A           ------------------------------DALSPYYMLIQEDGQVFGCWRILDTTGPYMLKNTFPELLH
2ae6A1          ---------------------------------------------------------------LAGFIEV
2a6aA2          ---------------------------------------------------------------VLVARRA
1cm0A           ---------------------------------------------------KHKTLALIKDGRVIGGICF
1lrzA3          ------------------------------PIFRSFMDDKFYYNRLKYYKDRVLVPLAYINELPISAGFF
2fl4A1          ----------------------------------------------------------YDGNQLIGYAMY
1mk4A           ---------------------------------------------------QDTSFITSEHNSMTGFLIG
1bobA           ------------------------------------------------PSWQIYWLLNKKTKELIGFVTT
2euiA1          ----------------------------------------------------------------------
1u6mA           ---------------------------------------------------------------DVRLFIE
1wwzA1          -------------------------------------------------KASDGFFVAKVGDKIVGFIVC
1s3zA           -------------------------------------------------ADHLASFIAMADGVAIGFADA
1yk3A1          ----------------------------------------------------------------------
1ozpA           ----------------------------------------------------------FGDGRLLGFHWT
2ge3A1          ------------------------------------------------IENDHPQFVAIADGDVIGWCDI
1nslA           ----------------------------------------------------------------------
2fsrA1          ------------------PAYRDFXASPRSTGVGGPYDLPSTLANWHFFGHGALXIDLGETGECIGQIGI
2bswA1          -------------------------------------------------LRGAFHLGGYYGGKLISIASF
1gheA           ----------------------------------------------------------AEDDNVLASAQL
2i6cA1          ------------------------------------------------------------DGQVLGFANF
1bo4A           ---------------------------------------------------TFIALAAFDQEAVVGALAA
1i12A           ----------------------------------------------------------KRTETVAATGNI
1y9wA1          ----------------------------------------------------------------------
1q2yA           ----------------------------------------------------------YDGEKPVGAGRW
1wk4A           ---------------------------------------------------GRLFVAESESGEVVGFAAF
1s7fA1          -------------------------------------------------RGYAKMYLIFCQNEMAGVLSF
1yreA1          --------------------------------MDGPTRPDWYRQSLAEQREGRALPLAVRLGVLVGTTRF
2fiaA1          ------------------QFLTEVKAYMDVVGITQWTKDYPSQGDIQEDITKKRLYLLVHEEMIFSMATF
1xmtA           ----------------------------------------------------------TEDHEAFIEYKM
1sqhA           ----------------------------------------------------------------------
2ozgA2          ---------------------------------------------------TLYSYLIGDKDKPQGYIIF
1b6bA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RNLPSINPLRICEIKRLYILPRARSLGYRQGAYQMQLSTRPGRKGYAEMRLDTLPTMHSAIALYKSLGF
1on0A           HAEPE-HPQQEAFIYDFGLYEPYRGKGYAKQALAA-LDQAARSXGIRKLSLHVFAHNQTARKLYEQTGF
1yx0A1          KELDT----RHGEIKSMRTSASHLRKGV--AKQVLQIIEEAEKRGYERLSLETMASFEPARKLYESFGF
1vhsA           ETFYGRPAYNKTAEVSIYIDEACRGKGVGSYLLQEALRIAPNL-GIRSLXAFIFGHNKPSLKLFEKHGF
2b3uA1          YFTYDPWIGKLLYLEDFFVXSDYRGFGIGSEILKN-LSQVAXRCRCSSXHFLVAEWNEPSINFYKRRGA
1y9kA1          LETRP----KTXEIXNIAVAEHLQGKGI--GKKLLRHAVETAKGGXSKLEVGTGNSSVSQLALYQKCGF
1vkcA           CTLDTVDYVKIAYIYDIEVVKWARGLGI--GSALLRKAEEWAKRGAKKIVLRVEID-NPAVKWYEERGY
1yr0A1          GDWRAFDGYRHTREHSVYVHKDARGHGIGKRLXQA-LIDHAGGNDVHVLIAAIEAENTASIRLHESLGF
1tiqA           NIDDAQSEEESLEIERIYIKNSFQKHGL--GKHLLNKAIEIALENKKNIWLGVWEKNENAIAFYKKXGF
1z4eA1          TPYLTYQGSWRATIEGVRTHSAARGQGI--GSQLVCWAIERAKEGCHLIQLTTDKQRPDALRFYEQLGF
1ro5A           GKEAPCSP-HIWELSRFAINSGQKGSLGFSDCTLEAMRALARYSLQNDIQTLVTVTTVGVEKMMIRAGL
2ae6A1          HPPTSLAAHQKQWLLSIGVSPDFQDQGIGGSLLSY-IKDXAEISGIHKLSLRVXATNQEAIRFYEKHGF
2a6aA2          RK-------GYHYCAVYLKDKGLNPLKE-PSVVSDEELEEITKEFSPKIVLKDDLLISPAVLVEESERL
1cm0A           RMFPSQ---GFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHD----ILNFLTYADEYAIGYFKKQGF
1lrzA3          FINP-----FEVVYYAGGTSNAFRHFAGSYAVQWEMIN-YALNHGIDRYNFYGVSGKFTVVKFKKGYNA
2fl4A1          GRWQD----GRVWLDRFLIDQRFQGQGYGKAACRLLMLKLIEKYQTNKLYLSVYDTNSSAIRLYQQLGF
1mk4A           FQSQS--DPETAYIHFSGVHPDFRKMQIGKQLYDVFIE-TVKQRGCTRVKCVTSPVNKVSIAYHTKLGF
1bobA           KYWHYIDKKFRAKISQFLIFPPYQNKGH--GSCLYEAIIQSWLEDKSITEITVEDPNEAFDDLRDRNDI
2euiA1          ---------RVWILNDIYVAEEAR----RQLVADHLLQHQXARTHAVRXRVSTSVDNEVAQKVYESIGF
1u6mA           EETLP----NEWYLDTISVDERFRGMGIGSKLLDALPE-VAKASGKQALGLNVDFDNPGARKLYASKGF
1wwzA1          DWFSKYEGRIVGAIHEFVVDKKFQGKGI--GRKLLITCLDFLGKYNDTIELWVGEKNYGAMNLYEKFGF
1s3zA           SIRHDYVNGCDVFLEGIFVLPSFRQRGVAKQLIAAVQR-WGTNKGCREMASDTSPENTISQKVHQALGF
1yk3A1          ---------YDLGLHAAIADLSKVNRGFGPLLLPRIVASFANEPRCRRIMFDPDHRNTATRRLCEWAGC
1ozpA           KVHPDHP--GLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRLVEPAVLLYVESDNVAAVRTYQSLGF
2ge3A1          RRQDR-ATRAHCGTLGXGILPAYRNKGLGARLXRRTLDAAHEF-GLHRIELSVHADNARAIALYEKIGF
1nslA           ---------NRKAEIGYWIAKEFEGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGF
2fsrA1          NHGPL----FPEKELGWLLYEGHEGRGYAAEAAVALRDWAFETLNLPTLVSYVSPQNRKSAAVAERIGG
2bswA1          HEHSELQGQKQYQLRGXATLEGYREQKA--GSSLIKHAEEILRKRG--ADLLWCNARTSASGYYKKLGF
1gheA           SLCQKPNGLNRAEVQKLXVLPSARGRGLGR-QLXDEVEQVAVKHKRGLLHLDTEAGSV-AEAFYSALAY
2i6cA1          YQWQHG---DFCALGNXXVAPAARGLGVARYLIGVXENLAR-EQYKARLKISCFNANAAGLLLYTQLGY
1bo4A           YVLPKFEQPRSIYIYDLAVSGEHRRQGIATALINLLKH-EANALGAYVIYVQADYGDDPAVALYTKLG-
1i12A           IIERKIELGLCGHIEDIAVNSKYQGQGLGK-LLIDQLVTIGFDYGCYKIILDCDEKNV---KFYEKCGF
1y9wA1          -----------LHIDFLWVDESVRHDGY--GSQLLHIEGIAKEKGCRLILLDSFS--FQAPEFYKKHGY
1q2yA           RMKDGY-----GKLERICVLKSHRSAGV--GGIIMKLEKAAADGGASGFILNAQT---QAVPFYKKHGY
1wk4A           GPDRASGFPYTAELWAIYVLPTWQRKGLGRALFHEGAR-LLQAEGYGRXLVWVLKENPKGRGFYEHLGG
1s7fA1          NAIEPIN---KAAYIGYWLDESFQGQGIMSQSLQALMTHYARRGDIRRFVIKCRVDNQASNAVARRNHF
1yreA1          AEFLPAL--PACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAIDKLGA
2fiaA1          CM---EQEQDFVWLKRFATSPNYIAKGYGSLLFHE-LEKRAVWEGRRKMYAQTNHTNHRMIRFFESKGF
1xmtA           RNNG-----KVMDLVHTYVPSFKRGLGLFEHASSHSISIIPS---CSYVSDTFLPRNPSWKPLIHSEVF
1sqhA           -------------------------------------------GEEITLTAWIVATNWRSEALLKRIGY
2ozgA2          TQERT-RDGSILRIRDWVTLSNPAVQSF--WTFIANH-----RSQIDKVTWKSSVIDALTLLLPE-QSA
1b6bA           ---------HSAHLHALAVHRSFRQQGK--GSVLLWRYLHHVGAQPA-VRRAVLMCEDALVPFYQRFGF