[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_02520

[Show Plain Result]

#ERROR : Can't open dsspfile "2ixnA1.bssp"
#ERROR : Can't open dsspfile "2g62A1.bssp"
#ERROR : Can't open dsspfile "2ixoA1.bssp"

## Summary of PDB Search
:424
    e-100  43%  2ixnA1 [a.268.1.1] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A A:3 --
    1e-96  34%  2g62A1 [a.268.1.1] PROTEIN PHOSPHATASE 2A, REGULATORY SUBUNIT B'
    3e-95  30%  2ixoA1 [a.268.1.1] SERINE/THREONINE-PROTEIN PHOSPHATASE 2A A:2 --
:424

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDRPTLTQHQFIRPVPRILSP
2ixnA1          --------------------------------------------------------------PEKRLLTP
2g62A1          -----------------------------------------------------------FIIPKKEIHTV
2ixoA1          --------------------------------------------------DRVDWPHATFSTPVKRIFDT


                         .         .         *         .         .         .         .:140
query           QDLETFLSSPAHSLIIAFVFNXXXXXXXXXXXXXXXXXXXETIRKVLSILSAIEELIDKHPSLDQNGSRF
2ixnA1          DDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPIS-ESINSMMNLLSQIKDITQKHPVI----KRF
2g62A1          PDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVS--EAIEKLVALLNTLDRWIDETPPVDQP-SRF
2ixoA1          QTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSAMVNGLMGVLDKLAHLIDETPPL----PGY


                         +         .         .         .         .         *         .:210
query           GNPAFRDLFDDIAAHSVQWHKDILGLDDPAAIEEVSTYLIHSLGSRSRLDFGSGHELNFMMWLLCLYLFG
2ixnA1          GKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYG
2g62A1          GNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIG
2ixoA1          GNLACREWHHKLDERLPQWLQEMLPSEYHEVVPELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLG


                         .         .         .         +         .         .         .:280
query           MLDRNDFPVIVCHVFIRYMKLMRHVQTTYYLEPAGSHGVWGLDDYHFIPFLFGAAQLTGHPYITPLAIHN
2ixnA1          IFNSNDSTNLVLKVFIEYLKIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHN
2g62A1          VLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPA------GLDDFQFLPFIWGSSQLIDHPYLEPRHFVD
2ixoA1          MFPHHRGA-DVFLLFNKYYTIMRRLILTYTLEPA------GLDDHFHLVYILGSSQWQAQAPLQPREILD


                         .         *         .         .         .         .         +:350
query           NVVLDEEGDNWIYLDQVRWVDSVKTVKGLRWHSPMLDDISGAKNWYKVEAGMKKMFVKEVLGKLPIMQHF
2ixnA1          NELVEMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDISGVKTWSKVAEGMIKMYKAEVLSKLPIMQHF
2g62A1          EKAVNENHKDYMFLECILFITEMKT-GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHF
2ixoA1          KSLVREYKDTNFYCQGINFINEVKM-GPFEEHSPILYDIAVTPRWSKVCKGLLKMYSVEVEKKFPVVQHF


                         .         .         .         .         *         .         .:420
query           LFGSLIPALPEMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ixnA1          YFSEFLP---------------------------------------------------------------
2g62A1          KFGSLLPIHPVT----------------------------------------------------------
2ixoA1          WFGTGFFPWVNI----------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxx
2ixnA1          ----
2g62A1          ----
2ixoA1          ----