[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_02566

[Show Plain Result]

#ERROR : Can't open dsspfile "1fj2A.bssp"
#ERROR : Can't open dsspfile "2r8bA1.bssp"
#ERROR : Can't open dsspfile "2h1iA1.bssp"
#ERROR : Can't open dsspfile "1ve6A2.bssp"
#ERROR : Can't open dsspfile "2gzrA1.bssp"
#ERROR : Can't open dsspfile "1xfdA2.bssp"
#ERROR : Can't open dsspfile "1ufoA.bssp"
#ERROR : Can't open dsspfile "1qlwA.bssp"
#ERROR : Can't open dsspfile "1aknA.bssp"
#ERROR : Can't open dsspfile "2b20A2.bssp"
#ERROR : Can't open dsspfile "1iunA.bssp"
#ERROR : Can't open dsspfile "1l7aA.bssp"
#ERROR : Can't open dsspfile "1acjA.bssp"
#ERROR : Can't open dsspfile "1a7uA.bssp"
#ERROR : Can't open dsspfile "1dinA.bssp"
#ERROR : Can't open dsspfile "2jbwA1.bssp"
#ERROR : Can't open dsspfile "1r1dA.bssp"
#ERROR : Can't open dsspfile "1dwoA.bssp"
#ERROR : Can't open dsspfile "3b5eA1.bssp"

## Summary of PDB Search
:287
    7e-32  26%  1fj2A  [c.69.1.14] PROTEIN (ACYL PROTEIN THIOESTERASE 1)
    1e-14  23%  2r8bA1 [c.69.1.14] UNCHARACTERIZED PROTEIN ATU2452 A:44 -- 246
    5e-12  17%  2h1iA1 [c.69.1.14] CARBOXYLESTERASE A:1 -- 202
    6e-11  19%  1ve6A2 [c.69.1.33] ACYLAMINO-ACID-RELEASING ENZYME A:322 -- 581
    7e-09  15%  2gzrA1 [c.69.1.38] IROE PROTEIN A:41 -- 305
    9e-08  22%  1xfdA2 [c.69.1.24] DIPEPTIDYL AMINOPEPTIDASE-LIKE PROTEIN 6 A:592
    4e-05  27%  1ufoA  [c.69.1.27] HYPOTHETICAL PROTEIN TT1662
    5e-05  12%  1qlwA  [c.69.1.15] ESTERASE
    9e-05  15%  1aknA  [c.69.1.1] BILE-SALT ACTIVATED LIPASE
    1e-04  15%  2b20A2 [c.69.1.2] ENTEROCHELIN ESTERASE A:151 -- 397
    1e-04  28%  1iunA  [c.69.1.10] META-CLEAVAGE PRODUCT HYDROLASE
    1e-04  15%  1l7aA  [c.69.1.25] CEPHALOSPORIN C DEACETYLASE
    2e-04  11%  1acjA  [c.69.1.1] ACETYLCHOLINESTERASE
    2e-04  26%  1a7uA  [c.69.1.12] CHLOROPEROXIDASE T
    2e-04  20%  1dinA  [c.69.1.9] DIENELACTONE HYDROLASE
    3e-04  15%  2jbwA1 [c.69.1.41] 2,6-DIHYDROXY-PSEUDO-OXYNICOTINE HYDROLASE A:8
    3e-04  15%  1r1dA  [c.69.1.29] CARBOXYLESTERASE
    6e-04  12%  1dwoA  [c.69.1.20] HYDROXYNITRILE LYASE
    8e-04  19%  3b5eA1 [c.69.1.14] MLL8374 PROTEIN A:7 -- 215
:287

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxMEAENRTFPDLHIVEPQAPHTHTAIFLHGRGSNGPEFTEDLFSSKTSGGQDLPSLFPSWRWVFPSS
1fj2A           ----MDPEFMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAF----------AGIRSSHIKYICPHA
2r8bA1          --------------FHKSRAGVAGAPLFVLLHGTGGDE----NQFFDFG-------ARLLPQATILSP--
2h1iA1          ----------------------------LLLHGTGGNEL----DLLPLA-------EIVDSEASVLSV--
1ve6A2          ----------------------------------------------------------------------
2gzrA1          ----------------------------------------------------------------------
1xfdA2          ----------------------------------------------------------------------
1ufoA           ----------------------------------------------------------------------
1qlwA           --------------VRYQIPQRAKRYPITLIHGCCLTGMTW------------ETTPDGRMGWDEYFLRK
1aknA           ----------------------------------------------------------------------
2b20A2          -------------RVWIFTTGDVTERLAVLLDGEF-----WAQSXPVWPVLTSLTHRQQLPPAVYVLIDA
1iunA           ----------------------------------------------------------------------
1l7aA           ----------------------------------------------------------------------
1acjA           ----------------------------------------------------------------------
1a7uA           ----------------------------------------------------------------------
1dinA           ----------------------------------------------------------------------
2jbwA1          ----------------------------------------------------------------------
1r1dA           ------------PKPFFFEAGER---AVLLLHGFTGNSADV------------RXLGRFLESKGYTCHAP
1dwoA           ----------------------------------------------------------------------
3b5eA1          -------ENSPLLTYRLLGAGKESRECLFLLHGSGVDETTL-----------VPLARRIAPTATLVAARG


                         .         .         *         .         .         .         .:140
query           GSRWNATFMEHQSAWFDIASLADTNRRQDLQIQGLKESSQYVLGVIEREIELLGGRSDNIIFGGLSQGMA
1fj2A           PVRPVTLNMNVAMSWFDIIGL-SPDSQEDE--SGIKQAAENIKALIDQEVK-NGIPSNRIILGGFSQGGA
2r8bA1          ----VGDVSEHGAARFF--------RRTVYDXVDLERATGKXADFIKANREHYQAG--PVIGLGFSNGAN
2h1iA1          ----RGNVLENGXRFFRRLAEGIFDEED------LIFRTKELNEFLDEAAKEYKFDRNNIVAIGYSNGAN
1ve6A2          ------------------------------------------------------GLASELYIMGYSYGGY
2gzrA1          ----------------------------------------------------------------------
1xfdA2          ----------------------------------------------------------------------
1ufoA           ----------------------------------------------------------------------
1qlwA           GYS-TYVIDQSGRGRSATDISAINAVKLGKAPA-----SSLPDLFAAGHEAAWAIFRFGPRYPDAFKDTQ
1aknA           -----------------------------------------AIAWVKRNIEAFGGDPDNITLFGESAGGA
2b20A2          IDTT------HRAHELPC----NADFWLAVQ--------QELLPLVKVIAPFSDRADRTVVAGQ-SFGGL
1iunA           ----------------------------------------------------------------------
1l7aA           ---------------------------------------------------------------GGSQGGG
1acjA           -----------------------------------------ALQWVHDNIQFFGGDPKTVTIFGESAGGA
1a7uA           ----------------------------------------------------------------------
1dinA           ----------------------------------------------------------------------
2jbwA1          ---------------------------------------------------------DAIGVLGRSLGGN
1r1dA           IYKGH-GVPPEELVHTGPDDWWQDVXNGYQFLKNKGYEKIAVA--------------------GLSLGGV
1dwoA           ----------------------------------------------------------------------
3b5eA1          RIPQ-------EDGFRWFERIDPT---RFEQKSILAETAAFA-AFTNEAAKRHGLNLDHATFLGYSNGAN


                         +         .         .         .         .         *         .:210
query           TALWTLLCSPGPVKGRIGAFVGCCGWIPFTLHIDQAIQLYRSKYASELGTSMCLIMPAFLLGTTGCPPFD
1fj2A           LSLYTALTTQQKL----AGVTALSCWLPLRASFPQGPI--------------------------------
2r8bA1          ILANVLIEQPELFDAAVLXH--------------------------------------------PLIPFE
2h1iA1          IAASLLFHYENALKGAV---------------------LHHPXVPRR-----------------GXQLAN
1ve6A2          MTLCALTMKPGLFKAGV-AGASVVDWEEMYELSDAAFRNFIEQLTGGSREIMRSRSPINHV---------
2gzrA1          -------------------------------------------------------------------DAL
1xfdA2          ----------------------------------------------------------------GLHGLD
1ufoA           ----------------------------------------------------------------------
1qlwA           FPVQAQAELWQQMVPDWLGSMPTPNPTVANLSKLAIKLDGTVLLSHSQSGITAAMNPKGITAIVSVEPGC
1aknA           SVSLQTLSPYNKGLIKRAISQSGVGLCPWAIQQDPLFWAKRIAEKVGCPVDDTSKMAGCLKITDPLTLAY
2b20A2          SALYAGLHWP----ERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEVSAEGLRIV-------------
1iunA           ----------------------------------------------------------------------
1l7aA           LTIAAAALSDIPKAAVA--------DYPYLSNFERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSY
1acjA           SVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQEL
1a7uA           ----------------------------------------------------------------------
1dinA           ------------------------------------------------------------------GVGL
2jbwA1          YALKSAACEP----RLAACISWGGFSDLDYWDLETPLTKES---------WKYVSKVDTLEEARLHVHAA
1r1dA           FSLK--LGYTVPIEGIVTXCAPXYIKSEETLEYAREYKKREGKSEEQIEQEXERFKQTPXKTLKALQELI
1dwoA           ----------------------------------------------------------------------
3b5eA1          LVSSLXLLHPGIV--RLAA----------------------------------LLRPXPVL---------


                         .         .         .         +         .         .         .:280
query           SKPEEVKAVLSTPVLLLHGTDDAVVDISLGQQACQLLKEMGMDVKFYEYSGAENEGHWIKEPDGFDQIAA
1fj2A           -----GGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLPANVTFKTYEG---MMHSSC-QQEMMDVKQ
2r8bA1          PKISPAKPT--RRVLITAGERDPICPVQLTKALEESLKAQGGTVETVWHPG----GHEIRSGE-IDAVRG
2h1iA1          LAG--------KSVFIAAGTNDPICSSAESEELKVLLENANANVTXHWENR----GHQLTXGE-VEKAKE
1ve6A2          -------DRIKEPLALIHPQNDSRTPLKPLLRLMGELLARGKTFEAHII---PDAGHAINTME--DAVKI
2gzrA1          LSRVTAVEPLQFCTKHLAIXEGSAGVLSKIHTTLTILKDKGVNAVFWDFPNL---GHGPXFNASFRQALL
1xfdA2          NRAYEMTKVAEQQFLIIHPTADEKIHF---QHTAELLIRGKANYSLQIY---PDESHYFTSSSLYRSIIN
1ufoA           -----------VPLLHLHGSRDHIVPLARXEKTLEALRPHYPEGRLARF-VEEGAGHTL-TPLXARVGLA
1qlwA           PKPEDVKPLTSIPVLVVFGDHIEEFPRWACHAFIDALNAAGGKGQLMSLPALHGNSHMMRNNLQVDLILD
1aknA           KLPLGSTEYPKLHYLSFVPVIDGDFIPDDPVNLYANAADVDYIAGTNDMDGHLFVGMDVPAINSNKQDV-
2b20A2          ---------------LEAGIREPXI-XRANQALYAQLHPIKESIFWRQVDGGHDALCW------------
1iunA           ---------LPNETLIIHGREDQVVPLSSSLRLGELID----RAQLHVFGRC---GHWIEQTDRFNRVVE
1l7aA           FDIMNLADRVKVPVLMSIGLIDKVTPPSTVF---AAYNHLETKKELKVY---RYFGHEPAFQTEKAFFKQ
1acjA           IDVEWNVLFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQILLGVN---KDEGSFFLLYG-------
1a7uA           ---------IDVPALILHGTGDRTLPI---ENTARVFHKALPSAEYVEVEGA---PHGWTHAEEVNTLLA
1dinA           EKQLNKVPEVKHPALFHMGGQDHFVPAPSRQLITEGFGANP-LLQVHWYEEA---GHSRTSSSGYVAAAA
2jbwA1          LETRDVLSQIACPTYILHGVHDEVPLSFVDTVLELVPAE---HLNLVVEKDG---DHCCLGIRPRLEXAD
1r1dA           ADVRAHLDLVYAPTFVVQARHDEXINPDSANIIYNEIE--SPVKQIKWYEQS---GHVIQEKDQLEDIYA
1dwoA           ---------GSIKKVYIWTDQDKIFLPDFQRWQIANYK----PDKVYQVQGG---DHKLTKTEEVHILQE
3b5eA1          -DHVPATDLAGIRTLIIAGAADETYGP-FVPALVTLLSRHGAEVDARIIPS----GHDI-GDPDAAIVRQ


                         .         *         .         .         .         .         +:350
query           FLESKTS
1fj2A           FIDKL--
2r8bA1          FLAA---
2h1iA1          WYD----
1ve6A2          LLP----
2gzrA1          DIS----
1xfdA2          FFV----
1ufoA           FLE----
1qlwA           WIGRNTA
1aknA           -------
2b20A2          -------
1iunA           FFN----
1l7aA           ILK----
1acjA           -------
1a7uA           FLA----
1dinA           LANERT-
2jbwA1          WL-----
1r1dA           FLES---
1dwoA           VADA---
3b5eA1          WL-----