[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_02920

[Show Plain Result]

#ERROR : Can't open dsspfile "1v5pA.bssp"
#ERROR : Can't open dsspfile "1u5dA1.bssp"
#ERROR : Can't open dsspfile "2fjuB3.bssp"
#ERROR : Can't open dsspfile "1btnA.bssp"
#ERROR : Can't open dsspfile "1ntyA2.bssp"
#ERROR : Can't open dsspfile "1dynA.bssp"
#ERROR : Can't open dsspfile "1zc3B1.bssp"
#ERROR : Can't open dsspfile "1v5mA.bssp"
#ERROR : Can't open dsspfile "1maiA.bssp"
#ERROR : Can't open dsspfile "1v89A.bssp"
#ERROR : Can't open dsspfile "1eazA.bssp"
#ERROR : Can't open dsspfile "2pggA1.bssp"
#ERROR : Can't open dsspfile "2cofA1.bssp"

## Summary of PDB Search
:1547
    3e-06  17%  1v5pA  [b.55.1.1] PLECKSTRIN HOMOLOGY DOMAIN-CONTAINING, FAMILY A
    8e-06  17%  1u5dA1 [b.55.1.1] SRC KINASE-ASSOCIATED PHOSPHOPROTEIN OF 55 KDA
    8e-05  14%  2fjuB3 [b.55.1.1] 1-PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE B:11 -- 141
    1e-04  14%  1btnA  [b.55.1.1] BETA-SPECTRIN
    1e-04   8%  1ntyA2 [b.55.1.1] TRIPLE FUNCTIONAL DOMAIN PROTEIN A:1415 -- 1535
    1e-04  13%  1dynA  [b.55.1.1] DYNAMIN
    2e-04  14%  1zc3B1 [b.55.1.1] EXOCYST COMPLEX PROTEIN EXO84 B:171 -- 279
    2e-04   7%  1v5mA  [b.55.1.1] SH2 AND PH DOMAIN-CONTAINING ADAPTER PROTEIN APS
    2e-04  14%  1maiA  [b.55.1.1] PHOSPHOLIPASE C DELTA-1
    5e-04  13%  1v89A  [b.55.1.1] HYPOTHETICAL PROTEIN KIAA0053
    6e-04  15%  1eazA  [b.55.1.1] TANDEM PH DOMAIN CONTAINING PROTEIN-1
    7e-04  15%  2pggA1 [e.8.1.4] RNA-DIRECTED RNA POLYMERASE A:31 -- 804
    8e-04  16%  2cofA1 [b.55.1.1] PROTEIN KIAA1914 A:8 -- 102
:1547

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxFISSTPAGNHTQRELHRYSSFDAQLFTLNTSSPAQAKRALEAHLAET
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          -----------------------FLQVPEANEGLKDEVTLLTQNIRDKAYGSGTYMGQATRLVAMKEVAT
2cofA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ERRLEETSNLGTALIEQQRELMDKLKEVEQQHTDGEIGPDLRRKLNDLEREYNEIGRETARVALGPKVRL
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          GRNPNKDPLKLGYTFESIAQLLDITLPVGPPGEDDKPWVPLTRVPSRMLVLTGDVDGDFEVEDYLPKINL
2cofA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           TGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          KS--------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDPRMIQAITQTMIGEFL
1v5pA           -----------------------------------------------------GSSGMPYVDRQNRICFL
1u5dA1          --------------------------------------------------------------------YL
2fjuB3          ------------------------------------------------------------VKAYLSGERF
1btnA           --------------------------------------------------------------------FL
1ntyA2          --------------------------------------------------------------------SF
1dynA           --------------------------------------------------------------------WL
1zc3B1          --------------------------------------------------------------------DL
1v5mA           --------------------------------------------------------------------AL
1maiA           --------------------------------------------------------------------SQ
1v89A           --------------------------------------------------------------------WL
1eazA           --------------------------------------------------------------------YC
2pggA1          ----------------------------------------------------------------------
2cofA1          --------------------------------------------------------------------YL


                         .         .         .         *         .         .         .:1330
query           WKYTRKLGRSDMSNTRHQRYFWVNPYTRTLYWGPHDPQVLAKSQQRSKSVAIEAVRVVNDDNPYPPGLHR
1v5pA           DIEDNENSGK-----FLRRYFILDTQANCLLWYMDNPQNLAVGAGAVGSLQLTYISKVSIATPKQKPKTP
1u5dA1          EKKSKDHSFF--GSEWQKRWCVVSR--GLFYYYANEKSKQPKGTFLIKGYSVRMAPHLRRDSKK----ES
2fjuB3          IKWDDETT------VASPVILRVDPKGYYLYWTYQSKFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTV
1btnA           NRKHEWENKKASSRSWHNVYCVINNQEMGFYKDAKSAA---SGIPYHSEVPVSLKEAICEVALDYKKKKH
1ntyA2          QVWDPKTLIRKG----RERHLFLFEMSLVFSKEVKDSSGR-SKYLYKSKLFTSELGVTEHVEGDPCKFAL
1dynA           TINNIGIMKG----GSKEYWFVLTA--ENLSWYKDDEEKEKKYMLSVDNLKLRDVEKGFMSSKHIFALFN
1zc3B1          VEYEADHMAQL-----QRVHGFLMN--DCLLVATWLPQRRGMYRYNALYPLDRLAVVNVKDNPPMKDMFK
1v5mA           RFMVADDAGPGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDN
1maiA           LLKVKSSSW------RRERFYKLQEDCKTIWQESRKVMRSPESQLFSIEDIQEVRMGLEKFARDIPEDRC
1v89A           KKQRSIVKN------WQQRYFVLRAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPA
1eazA           VKQGAV-------MKNWKRRYFQ-LDENTIGYFKSE-----LEKEPLRVIPLKEVHKVQECKQSDIMMRD
2pggA1          ----------------------------------------------------------------------
2cofA1          NVLVNS--------QWKSRWCSVRDNHLHFYQDRNR------SKVAQQPLSLVGCEVVPDPSPDH---LY


                         .         +         .         .         .         .         *:1400
query           KSLEIITPGRTLKFTAATSQRHETWFNALSYLLLRTAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           FCFVINALSQRYFLQANDQKDLKDWVEALN----------------------------------------
1u5dA1          CFELTSQDRRTYEFTATSPAEARDWVDQISFLLKDLS---------------------------------
2fjuB3          VSGPDMVDLTFHNFVSYKENVGKAWAEDVLALVKHP----------------------------------
1btnA           VFKLRLSDGNEYLFQAKDDEEMNTWIQAI-----------------------------------------
1ntyA2          WVGRTPTSDNKIVLKASSIENKQDWIKHIR----------------------------------------
1dynA           TEQRNVYDYRQLELACETQEEVDSWKASF-----------------------------------------
1zc3B1          ----LLMFPESRIFQAENAKIKREWLEVL-----------------------------------------
1v5mA           TFVLKVENGAEYILETIDSLQKHSWVADIQ----------------------------------------
1maiA           FSIVFKDQRNTLDLIAPSPADAQHWVQGLRKII-------------------------------------
1v89A           SWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGS-----------------------------------
1eazA           NLFEIVTTSRTFYVQADSPEEMHSWIKAV-----------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          SFRILHKGEELAKLEAKSSEEMGHWLGLLL----------------------------------------


                         .         .         .         .         +         .         .:1470
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1v5pA           ----------------------------------------------------------------------
1u5dA1          ----------------------------------------------------------------------
2fjuB3          ----------------------------------------------------------------------
1btnA           ----------------------------------------------------------------------
1ntyA2          ----------------------------------------------------------------------
1dynA           ----------------------------------------------------------------------
1zc3B1          ----------------------------------------------------------------------
1v5mA           ----------------------------------------------------------------------
1maiA           ----------------------------------------------------------------------
1v89A           ----------------------------------------------------------------------
1eazA           ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
2cofA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:1610
query           xxxxxxx
1v5pA           -------
1u5dA1          -------
2fjuB3          -------
1btnA           -------
1ntyA2          -------
1dynA           -------
1zc3B1          -------
1v5mA           -------
1maiA           -------
1v89A           -------
1eazA           -------
2pggA1          -------
2cofA1          -------