[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_02989

[Show Plain Result]

#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "2hydA2.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1pf4A2.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1oy5A.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1jmu.1.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "1l8qA2.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1f48A2.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1a82A.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1bifA1.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1qvrA2.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1pujA.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1oftA.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "2hydA2.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "1pf4A2.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1oy5A.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "1l8qA2.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1f48A2.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1bifA1.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"

## Summary of PDB Search
:1343
    3e-46  17%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    8e-46  27%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    3e-43  21%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-42  21%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    3e-41  45%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    1e-39  20%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    5e-38  26%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-37  16%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    3e-36  13%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    2e-35  26%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    2e-33  13%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    2e-31  16%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    1e-30  11%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC A:260
    3e-30  13%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    3e-30   5%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    1e-29  10%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    3e-29  12%  1rkbA  [c.37.1.1] PROTEIN AD-004
    3e-29  10%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    4e-29  11%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    1e-28  10%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    4e-28  11%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    8e-28   7%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    4e-27   8%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    5e-27  10%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    1e-26  14%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    1e-26  11%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    4e-26   9%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 -- 417
    3e-25  13%  2hydA2 [f.37.1.1] ABC TRANSPORTER HOMOLOG A:1 -- 323
    4e-25  12%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    4e-25  14%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    5e-25  12%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    3e-24  16%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    3e-24  10%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    9e-24   8%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    1e-23  16%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    1e-23  15%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2 --
    3e-23  14%  1jbkA  [c.37.1.20] CLPB PROTEIN
    4e-23  12%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    5e-23  12%  1g6oA  [c.37.1.11] CAG-ALPHA
    7e-23  11%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    1e-22  12%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    1e-22  23%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-22   7%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    5e-21  16%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    8e-21  10%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    8e-21  18%  1jb1A  [c.91.1.2] HPRK PROTEIN
    9e-21  10%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    9e-21  13%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    9e-21  13%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    2e-20   8%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    8e-20  10%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    9e-20  11%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    1e-19  17%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    2e-19   9%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    2e-19   7%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    2e-19  25%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    4e-19  11%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    5e-19  13%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    6e-19  11%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    7e-19  13%  1pf4A2 [f.37.1.1] TRANSPORT ATP-BINDING PROTEIN MSBA A:10 -- 320
    8e-19  14%  1t3wA  [a.236.1.1] DNA PRIMASE
    9e-19  11%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    1e-18  15%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    2e-18   4%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    2e-18  13%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    3e-18  11%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    4e-18  11%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    4e-18  15%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    4e-18   5%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL) A:141
    4e-18  12%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    4e-18  15%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    5e-18  12%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    6e-18  12%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    6e-18  13%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    1e-17  12%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    1e-17  11%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    1e-17   7%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    1e-17  13%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    2e-17  11%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    2e-17  14%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    3e-17  12%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    4e-17  14%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    8e-17   9%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    1e-16  19%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    2e-16  11%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    2e-16  16%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    2e-16  15%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    2e-16  16%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    3e-16   8%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    3e-16  13%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    4e-16  10%  1sbxA  [a.6.1.4] SKI ONCOGENE
    6e-16   8%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    6e-16  11%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    1e-15  22%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    5e-15  11%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    6e-15  11%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    9e-15  14%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    2e-14   6%  1mi8A  [b.86.1.2] DNAB INTEIN
    2e-14  11%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    2e-14  13%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    3e-14  13%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    8e-14   8%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    1e-13  10%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    3e-13   7%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    6e-13   8%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    8e-13  17%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    9e-13  15%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    1e-12  23%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    2e-12  11%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    6e-12   9%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    7e-12  12%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    1e-11  12%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    3e-11  18%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    8e-11  12%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    8e-11  12%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    2e-10  12%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    4e-10  15%  1oy5A  [c.116.1.4] TRNA (GUANINE-N(1)-)-METHYLTRANSFERASE
    8e-10  14%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    9e-10  19%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    4e-09   9%  1jmu.1 [e.35.1.1] PROTEIN MU-1 A:- -- - B:- -- -
    8e-09  14%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    1e-08  12%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    1e-08  10%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    1e-08   8%  1g31A  [b.35.1.1] GP31
    2e-08  12%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    7e-08  14%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    1e-07  10%  1oa8A  [b.145.1.1] ATAXIN-1
    1e-07  11%  1dekA  [c.37.1.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    1e-07  16%  1l8qA2 [c.37.1.20] CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA
    2e-07  13%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    4e-07  24%  1f48A2 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:309 -- 586
    5e-07   8%  1e6vC  [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    1e-06  10%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --
    1e-06  11%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    1e-05  11%  1a82A  [c.37.1.10] DETHIOBIOTIN SYNTHETASE
    4e-05  22%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    4e-05  15%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    5e-05  18%  1bifA1 [c.37.1.7] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTOSE-2,6- A:37 --
    5e-05  12%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    7e-05  32%  1qvrA2 [c.37.1.20] CLPB PROTEIN A:149 -- 535[MASQUE : MEMB(X) 0 /
    9e-05  14%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    1e-04  21%  1pujA  [c.37.1.8] CONSERVED HYPOTHETICAL PROTEIN YLQF
    2e-04  20%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    4e-04  12%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    5e-04  10%  1oftA  [c.37.1.22] HYPOTHETICAL PROTEIN PA3008
    7e-42  17%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN(query 1115->1323)
    2e-45  26%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE(query 1098->1331)
    4e-43  25%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE(query 1098->1333)
    8e-39  20%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER(query 428->649)
    4e-41  47%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564(query 405->659)
    3e-33  18%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706(query 1117->1331)
    1e-34  23%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD(query 442->663)
    5e-37  14%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE(query 1114->1331)
    1e-35  14%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE(query 447->727)
    2e-35  27%  1ji0A  [c.37.1.12] ABC TRANSPORTER(query 1098->1327)
    5e-30  12%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223(query 1125->1323)
    1e-30  14%  1ex6A  [c.37.1.1] GUANYLATE KINASE(query 457->646)
    1e-28   9%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC A:260(query 441->663)
    3e-25  17%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)(query 428->618)
    1e-28   6%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN(query 1116->1326)
    7e-29   7%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489(query 1029->1331)
    9e-28  11%  1rkbA  [c.37.1.1] PROTEIN AD-004(query 455->632)
    3e-28  12%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB(query 421->812)
    1e-27  12%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278(query 456->709)
    4e-27  12%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3(query 407->662)
    1e-22  11%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE(query 1126->1306)
    3e-24   8%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379(query 1060->1337)
    2e-25   4%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253(query 1176->1322)
    1e-25  13%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT(query 1098->1333)
    1e-25  15%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE(query 456->674)
    2e-23   8%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2(query 1126->1326)
    2e-23   9%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 -- 417(query 428->663)
    2e-19  14%  2hydA2 [f.37.1.1] ABC TRANSPORTER HOMOLOG A:1 -- 323(query 820->1079)
    2e-24  11%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336(query 453->647)
    5e-25  11%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN(query 1053->1337)
    8e-23   9%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251(query 436->662)
    3e-23  17%  1ffhA2 [c.37.1.10] FFH A:89 -- 295(query 1119->1323)
    4e-22   9%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373(query 1091->1331)
    2e-23  10%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --(query 1209->1340)
    2e-20  15%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173(query 1143->1328)
    2e-18   9%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2 --(query 428->632)
    1e-15  13%  1jbkA  [c.37.1.20] CLPB PROTEIN(query 422->609)
    8e-23  13%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165(query 1129->1282)
    2e-22  14%  1g6oA  [c.37.1.11] CAG-ALPHA(query 430->637)
    1e-22  17%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244(query 522->650)
    1e-20  12%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181(query 1126->1296)
    9e-17  24%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN(query 426->667)
    2e-22  10%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK(query 456->647)
    3e-20  16%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE(query 1129->1304)
    8e-21  12%  1e6cA  [c.37.1.2] SHIKIMATE KINASE(query 1129->1283)
    3e-19  15%  1jb1A  [c.91.1.2] HPRK PROTEIN(query 442->615)
    5e-19   7%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE(query 1111->1336)
    1e-17  15%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA(query 428->687)
    1e-20  13%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188(query 447->611)
    1e-17   7%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622(query 445->633)
    9e-17   9%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)(query 388->620)
    6e-19  11%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397(query 306->524)
    6e-19  16%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865(query 522->605)
    5e-19  10%  1n25A  [c.37.1.20] LARGE T ANTIGEN(query 450->667)
    2e-17   8%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)(query 427->558)
    1e-16  25%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID(query 1098->1325)
    8e-18  10%  1s9hA  [c.37.1.20] REP 40 PROTEIN(query 399->634)
    8e-19  16%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150(query 456->593)
    4e-18  11%  1viaA  [c.37.1.2] SHIKIMATE KINASE(query 457->616)
    9e-19  15%  1pf4A2 [f.37.1.1] TRANSPORT ATP-BINDING PROTEIN MSBA A:10 -- 320(query 758->1075)
    7e-18  12%  1t3wA  [a.236.1.1] DNA PRIMASE(query 1139->1286)
    8e-17   9%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE(query 1125->1332)
    2e-18  15%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607(query 1239->1324)
    4e-17   8%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445(query 1215->1320)
    7e-15  13%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT(query 445->569)
    8e-17   9%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN(query 449->571)
    9e-17  12%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE(query 443->633)
    4e-15  10%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065(query 421->590)
    4e-17   6%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL) A:141(query 425->580)
    5e-17  16%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411(query 453->647)
    1e-16  15%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123(query 1168->1293)
    2e-15  13%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE(query 1163->1338)
    1e-17  10%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321(query 519->630)
    8e-16  14%  1vhhA  [d.65.1.2] SONIC HEDGEHOG(query 1203->1343)
    4e-17  10%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395(query 1189->1337)
    4e-16  10%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I(query 397->588)
    5e-16   9%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283(query 548->684)
    1e-10  16%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366(query 426->559)
    1e-14  12%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800(query 425->635)
    3e-14  15%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198(query 1154->1295)
    6e-16  15%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE(query 569->694)
    1e-15  19%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -(query 1142->1325)
    4e-15   7%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA(query 1141->1286)
    6e-16  24%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA(query 541->611)
    1e-12   8%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180(query 428->607)
    6e-15  10%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135(query 1245->1322)
    2e-15  13%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE(query 422->653)
    9e-15  12%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132(query 1205->1331)
    5e-13   8%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173(query 1177->1312)
    2e-15  10%  1esmA  [c.37.1.6] PANTOTHENATE KINASE(query 399->659)
    3e-15   9%  1sbxA  [a.6.1.4] SKI ONCOGENE(query 1239->1325)
    1e-14   9%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200(query 1204->1338)
    4e-15  10%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306(query 447->601)
    7e-15  21%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -(query 1051->1308)
    5e-13  10%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348(query 1226->1318)
    5e-14  12%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS(query 456->638)
    4e-13  11%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180(query 417->571)
    3e-14   8%  1mi8A  [b.86.1.2] DNAB INTEIN(query 420->558)
    5e-12  12%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --(query 1126->1306)
    2e-13  12%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381(query 1224->1308)
    2e-13  14%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206(query 1126->1271)
    3e-11  10%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92(query 542->601)
    8e-12   9%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225(query 428->516)
    5e-12  12%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2(query 1154->1320)
    8e-13   8%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --(query 594->709)
    7e-11  16%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)(query 1125->1316)
    6e-11  13%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1(query 1087->1200)
    2e-09  23%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1(query 1237->1307)
    3e-12  10%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE(query 1165->1261)
    5e-10   7%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --(query 1239->1314)
    5e-11  14%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87(query 1227->1300)
    7e-11  12%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --(query 450->624)
    6e-10  17%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480(query 1272->1341)
    9e-10  13%  1e2hA  [c.37.1.1] THYMIDINE KINASE(query 1124->1340)
    1e-08  11%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --(query 1118->1173)
    6e-10  11%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244(query 459->663)
    6e-09  18%  1oy5A  [c.116.1.4] TRNA (GUANINE-N(1)-)-METHYLTRANSFERASE(query 1205->1279)
    3e-09  13%  1gm5A1 [a.24.21.1] RECG A:7 -- 105(query 519->629)
    2e-09  13%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494(query 400->482)
    4e-08  13%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2(query 460->600)
    6e-08  14%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511(query 1123->1172)
    3e-07  10%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228(query 447->562)
    5e-07  11%  1g31A  [b.35.1.1] GP31(query 1250->1318)
    9e-08   9%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT(query 1256->1325)
    9e-08  11%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298(query 479->568)
    1e-06  13%  1oa8A  [b.145.1.1] ATAXIN-1(query 536->633)
    2e-05  12%  1dekA  [c.37.1.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE(query 1129->1255)
    3e-04  13%  1l8qA2 [c.37.1.20] CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA(query 461->613)
    1e-04   8%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172(query 460->607)
    6e-05  18%  1f48A2 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:309 -- 586(query 440->506)
    2e-06   5%  1e6vC  [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT(query 1234->1272)
    1e-06  11%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --(query 1113->1194)
    4e-06  14%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171(query 1227->1308)
    6e-04  24%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)(query 456->489)
    2e-04  26%  1bifA1 [c.37.1.7] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTOSE-2,6- A:37 --(query 1129->1173)
    6e-04  20%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE(query 456->490)
:1343

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxILGTISY
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ---------------------------------------------------------------LLDEGFG
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DEFNDTLSKYALYFVYLGIAEFVLIYTCTVGFIYTGEHIAQKIRERYLDAVLRQNIAFFDKLGAGEITTR
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          EKVHHLTIAIGIALFIFVIVRPPIEFIRQYLAQWTSNKILYDIRKKLYNHLQALSARFYANNQVGQVISR
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          NAESNFLRILPFMILGLMFVRGLSGFASSYCLSWVSGNVVMQMRRRLFNHFMHMPVRFFDQESTGGLLSR
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ITADTNLIQDGISEKVGXXXXXXXXXXXXXXIGFIKYWKLTLICCSTVVAIVTIMGGASRFIIRFSKKNV
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          VINDVEQTKDFILTGLMNIWLDCITIIIALSIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLTRERS
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ITYDSEQVAGATSR-----------------------------------ALVSIVREGASIIGLLTLMFW
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ESYGEGGTVAEEVLSSIRNATAFGTQEKLAKQYDAHLLEAQKWGTKLQMTIGIMVGGMMSIVFLNYGLGF
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          -----------------------------------------------RASVGKMIDGIGRFYIQMCTELK
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          QALAEVQGFLHERVQGISVVKSFAIEDNEAKNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVI
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          NSWQLSLVLIVVAPVVAFAISFVSKRFRKISRNMQTAMGHRQQTMKLVSAQSIADPVIQMIASLALFAVL
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          -------------------------SKTLKDARDKIVEGTLYSNVSDLIQQFNQMIITMNGNEFQTGGIG
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           WMGSRFIVSGXXXXXXXXXXXXXXXXGSFSLGNVTPNAQAFTSAIAAGAKIFSTIDRKSPIDPTSEDGET
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           -----------------------------------------------------------------ENVTA
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          LSDYEGRL--------------------------------IQNSLTIERMVLSAFDTGGPIRRVDGKWRR
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ------------------------------------------VGEELLGRVVDALGNAIDGKGPIGSKAR
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------FTGFPVITDQPLPEDKQIPDWFFSVEDYDK
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          GVGAYLAISGSITVGTLAAFVGYLELLFGPLRRLVASFTTLTQSFASMDRVFQLIDEDY-----------
2yyeA2          ----------------------------------------------------------------------
1urjA           ---------------------------STQAPNLT-------RLCERARRHFGFSDYTPRPGDLK-----
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          FLASVDSIRAELTPGTFTVVFSAMFGLMRPLKALTSVTSEFQRGMAACQTLF------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           -----------------------------------------------------------------DEGGD
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          -----------------------------------KSETSLKLSLRNLKGGLRDFVDSL----RRELIEV
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           -------------------------------------------------------------------MEL
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ------------------------------------------------------MDLETERDNGKYE---
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           --------------------------------------------------------QEAAIATREELAEM
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           -------------------------------------VNRINAFKPTADRPF-VLGLPTGGTPMTTYKAL
1qhdA1          NLPIRNWNFDFGLLGTTL----------LNLDANYVETARNTIDYFVDFVDNVCMDEMVRESQRNGIAPQ
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ------------------------------------------------AGKIMSLTKTAPDYLVGQQPVE
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------SEHLMLVDLARNDLARICTPGSRY
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ------------------------------------------------NQWAALRDSVPXTL-SEDEIAR
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ------------------------------------------------------------------GDYN
1mi8A           ---------------------------------------------------------------------S
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          -------------------------------------------------SSSTQNVFVILXDKCL--PKV
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LEKVEGNIEFRDIRHIYPSRPEVLVMKGVNLFVPAGKTTALVGPSGSGKSTVIGLLERFYNPVGGSVLVD
1e69A           ------KLYLKGFKSF----------GRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAG
1b0uA           -------LHVIDLHKRYGGHE---VLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVN
1q3hA           FWEEGFGELLEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHS
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          --------------------------KGIKLKIK-GKSLILAQTRE----EAKEKLIPVINKIKDVDLVI
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------YTDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSN
1poiA           ----------------------------------------------------------------------
1ji0A           -------LEVQSLHVYYGAIH---AIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFN
1nijA1          -----------------------------------IAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIEN
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           --------------------------MQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKI--KL
2iqhA1          ELILYDKEEIRRIWRQANNGDDAMMIWHSNLNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRRSGAAGA
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------TTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVD
1bmfA3          RRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEK
2gk3A1          ----------------------------------------------------------------------
1mjgM           IVQIAMETRGIKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGK-IEVI
1jjvA           ----------------------------------------------------------------------
1udwA           -----------------------------------PFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQD
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           -----HETTGEALCERLGLDPDLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMP
2v3jA1          ----------------------------------------------------------------------
1ffhA2          --------------------------EARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLV
2gx8A1          ------------------------PVTHAEEVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPQQLEVRIE
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------MRGMLPLFEPKGRVLLVD
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ---------------------------------------ILEGPDCCFKSTVAAKLSKELKYPIIKGSSF
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------GGNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSD
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           -----------------------------------TIQIAIDGPASSGKSTVAKIIAKDF---GFTYLDT
1e6cA           ------------------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIF
1jb1A           ----------------------------------------------------------------------
1afrA           --------------------PPREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLP
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           -------LRTENIVKYFGEFK---ALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFE
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ------------------------------------------------KRTTXRILIGVQNPELATLVPP
1tmkA           -----------------------------------GKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFP
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          -------------------------------------------------------------DPQDDVYLD
1f8xA           ----------------------------------------------------------------------
1ii8.1          ------------------------------------------------------RTERERVKKEIKDLEK
1f46A           ------------------------------------------------------AVIIMNVAAHHGSELN
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ---------------------------------PKGVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDM
2vgmA3          ----------------------------------------------------------------------
2ancF1          -----------------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIE
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           --------------------------------------------------------------FVGYSIYK
1a4iA2          ----------------------------------------------------------------------
1ckeA           -----------------------------------APVITIDGPSGAGKGTLCKAMAEAL----QWHLLD
1tueA           WRPIVQFLRYQQIEFIT--FLGAL--KSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVIS--FV
1w1wA           -----------------------------------SNFTSIIGPNGSGKSNMMGVLKDLIYRGPQSAYVK
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ---------------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYW
2je6I3          ---------------------------GIVIDIMPVKVPRVIGKNKSMYETLTSK--SIFVANNGRIWAF
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          --------------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYK
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ------------------------------------KLIFLSGVKRSGKDTTADFIMSNYSAVKYQLAGP
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          LAEIRVELDYPDEIETNTGEVVTRLERIKEKLTEELKLNRGQEIFERGSDSLITNLRQKQLLENIKSLKE
1iqrA2          ----------------------------------------------------------------------
1a82A           ------------------------------------KRYFVTGTTEVGKTVASCALLQAAKAAGYRTAGY
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------MVGLPARGKTYISKKLTRYLNFIGVPTRE-
1eg7A           ARGLGIQEDEVELYGKY--KAKISLDVYRRLDKPDGKLILVTTPAGEGKTTTSVGLTDALARLGKRVMVC
1qvrA2          ---------------------QILLRRTKNNPV-------LIGEPGVGKTAIVGLAQRI---VKGDVGLK
1dwmA           ----------------------------------------------------------------------
1pujA           -----------------------------------------IGIPNVGKSTLINRLAKKNVKVGELELLD
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ---------------------------------PAAFSELSLSGLPGHCLTLLAPILRELSEEQDARWLT
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           -------LEIRDLSVGYDKP----VLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYN
1pf4A1          AERVNGEVDVKDVTFTYQGK-EKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLD
1yvuA2          ----------------------------------------------------------------------
1l7vC           ---------------------ESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXTSGKGSIQ-FA
1m3eA1          ----------------------------------------------------------------------
1poiA           --------------------------DAIAKYVHSGDHIALGGFTTDRKPAVFEILRQGITDLTGLGGAA
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ------------------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSS
1khbA1          --------------------AEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDD
1qhlA           -------GKFRSLTLINW---NGF--FARTFDLDELVT-TLSGGNGAGKSTTMAAFVTALIPDLTLLLHG
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------LLPNILLTGTPGVGKTTLGKELASKSGL--KYINVG
1e9rA           GTRIVSGGKLKRMTREKAKQV---TVAGVPMPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIV
1jalA1          -----------------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTG
1mukA           DETL-----MRARRHSYSS-----FSKLLEAYLLVK---WRMCEAREPSVDLCAGID----PLNSDPFLK
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           -----------------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPVDADVVAR
1udwA           ----------------------------------------------------------------------
1pv4A3          -------ILFENLTPLHANSRLTARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLX
2hydA2          ----------------------------------------------------------------------
2yyeA2          --------------------------------AQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIEN
1urjA           ----------------------------------------------------------------------
2v3jA1          ---------------LVPQAP-----PVLTSKDKITKRXIVVLAXASLETHKIYVLLNCDDHQGLLKKXR
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          -------FRYRGPSPKGDQPK---AIAGLVEALDGERFVTLLGATGTGKTVTMAKVIEALGRPALVLAPN
1jbkA           -YTIDLTERAEQGKLDPVIRDEEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLK
2axpA1          ----------------------------------------------------------------------
1g6oA           ---------FEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIE
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           -----GAVVVKDLRKRIGKKE---ILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVF
1kgdA           -----------------------------------RKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPH
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ---------------------ERRSXHGVLVDIY-GLGVLITGDSGVGKSETALELVQRGHRLIADDRVD
1afrA           ----------------------------------------------------------------------
1g8yA           -------HKPINILEAFAAAPPPL--DYVLPNMVAGTVGALVSPGGAGKSMLA-----------------
1atrA1          --------------------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTD
1tljA           ------------------------ALNKIYHDKEIGYLDPDILG------FLLAFYRNRNDVYTQSSCSG
1cd5A           VEMHAGQVSFKHVVTFNM--DEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQY
1qhdA1          SDSLIKLSGIKFKRINFDNSSEYIEN--WNLQNRRQRTSVLADASETMLANVT-SVRQEYAIPVGPVFPP
1iioA           ----------------------------------------------------------------------
1n25A           -----------------------------VYNIPKKRYWLFKGPIDSGKTTLAAALLELCGNVNLPLDRL
1ckvA           ------NAYDAGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIK
1g6hA           ----------------------------------------------------------------------
1s9hA           DISSNRIYKILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTN
1xbtA1          -----------------------------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVI
1viaA           ------------------------------------KNIVFIGFXGSGKSTLARALAKDLDLVFLDSDFL
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ------------------------RINAGMLAQFIDKPVCFVGRLEKIHPT--GKMFILSDGEGKNGTIE
1l7lA           ----------------------------VLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGD
1d6jA           ----------------------LTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYR
1fl9A           MESLTQYIPDEFSMLRFGKKF---AEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPT
1pgsA2          ----YNKSSIDGVPYGKAHTLGLKKNIQLPTNEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAIN
1lw7A2          --------------------------------PFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGR
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           VADLTKVDRYSYVMHLV-SRVVGELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRG-----
1zbsA1          ----------------------------------------------------------------------
1jqjA3          -----GCDLLKQARAAAASNE---KFRGVRLYVSENQLKITANNPEQEE-----------AEEILDVTYS
1e3mA2          ----KPGIRITEGRHPVVEQVNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVP
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          -------LKAGGKIYQGWTKIITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERV
1v47A1          ----------------------------------------------------------------------
1cr0A           -ERIREHLSSEEVGLLFSGCT---GINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMG-----
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           LKGINEDLSLEEVAEIYLPRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSR--------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          --------------------------KVQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYA
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           -----------------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLI
1ovmA2          LQFLDHVIDSPDICWVGC-ANELNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIV
1mi8A           LASTGKRVSIKDLLDEKDFEIWAINE--QTMKLESAKVS-RVFMTGKKLVYILKTRLGRTIKATANHRFL
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          -------TITAAHRKSFPNRVWLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLL-APLKGQSEGYGVI
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          -----------------------------SLLSPNPEVVVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTL
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          --------------------------------------VVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVN
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          R------IRTRRAAELLDKRIVIIDSWPTTHKYPLGHFVRDLGTIESAQAETEALLLEHDVE--------
1odfA           ---------------------------------------FFSGPQGSGKSFTSIQI--------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          --------------------------ASVITEIKAEDLQQLL-----RVSRGLQIDTIAITNKDGKIVIN
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------ELIHTSGGLVAD
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------IYGSVGTGKTHLLQAAGNEAKKRGYRVISS
1mkyA1          ---------------------------------------LIVGRPNVGKSTLFNKLVKDPVQDTVEWYGK
1f48A2          -------------------RPDIPSLSALDIARNEHGLIMLMGKGGVGKTTMAAAIAVRLADMGFDVHLT
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           -----------------------------------SKYIVIEGLEGAGKTTARNVVVETLEQLGIRDMV-
1bifA1          ----------------------------------------------------------------------
1p5zB           -----------------------------------IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPV


                         *         .         .         .         .         +         .:560
query           GVDIQNLNLKWLRQQISLVSQEPTLFGTTIYNNIKQGLIGSPFELEPDQSVRQRIENAAKMANAHDFIMG
1e69A           SENLPPAGSAYVELVFEENGEEITVARELKRTGENTYYLNGSGVDFYSIVGQGQIDRISLLFFGGEGRLE
1b0uA           GQNINLVRDKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVHDARERALKYLAKVG
1q3hA           GRVSFCSQFSWIMPGTIKENIIFGVSYDEYRYKSVV-----------------------KACQLQQDITK
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          VFLEFLLFVKRELLKKXIPSQVILNRTLFVLLNVAEQV-------------------LAKTGNIPYKLKE
1l7vC           ----------------------------------------------------------------------
1m3eA1          NAGVDNFGLGLLLRXISSYVGENAEFERQYLAGELEVE----------LTPQGTLAERIRAGGAGVPAFY
1poiA           ----------------------------------------------------------------------
1ji0A           GQDITNKPAHVINRGIALVPEGRRIFPELTV-------------YENLXXGAYNRKDKEGIKRDLEWIFS
1nijA1          EFGEVSVDDQLIGDRATQIKTLTNGCCCSRSNELEDALL-------------DLLDNLDKGNIQFDRLV-
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           NQELAEELYATGNYDAMYFAGIIADPKAMSESDFDRWI--------DGAYFYMLSDYVVAV-------TL
2iqhA1          AVKGVGTMVMELIRMIKRGINRRTRIAYRMCNILKGKFQTAAQR---------TMVDQVRESRNPGNAEF
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           SLIEAMPLKMQSAEGGIEFDADGGVSIGPEFRALEG--------------AWAEGVVAMARAGARIIIDD
1bmfA3          KKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDA--------APLQYLAPYSGCSMGEYFR
2gk3A1          ---------------LKVLFIGESW---HIHXIHSKGY--DSFTSSKYEEGATWLLECLRKGGVDIDYXP
1mjgM           GPDIDQIPEGSKLPLGILVDIYGRKMQADFEGVLE----------------RRIHDFINYGEGLWHTGQR
1jjvA           ----------------------------------------------------------------------
1udwA           SFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLK--------EITEGKTVQIPVYDFVSHSRKEETV
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           DFSREPFNANHRSIGEKFTYPLPFFLFEAVVGPAAVAL-------------RSRNVDAVARAAAHLAFDE
2v3jA1          ----------------------------------------------------------------------
1ffhA2          AADTQRPAAREQLRLLGEKVGVPVLEVMDGESPE-------------------SIRRRVEEKARLEARDL
2gx8A1          TIIPASLQRKVIKAMVTAHPYEEVAYVYPLDNKGETLGLGKIGY----------LQEEMTLGQFAEHVKQ
1o7d.2          ----------------------------------------------------------------------
1bgxT2          GHHL--------------AYRTFHALGLTTSRGEPVQAVYGFAK---------SLLKALKEDGDAVIVVF
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ELAKSGNEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIE-----DKIKAKAKVVY
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          DLWGYI----KHGRIDPWLPQSH------QQNRXIXQIAADVAGRYAKEGYFVILDGVVRPDWLPAFTAL
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           GAMYRAATYMALKNQLALLDQHPISFGRSETGDQLVFVGDVDITHPIR---ENEVTNHVSAIAAIPEVRE
1e6cA           MQHTSGMTVADVVAAEGWPGFRRRESEALQAVATPNRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEE
1jb1A           ----------------------------------------------------------------------
1afrA           DPASDGFDEQGDMITEEALPTYQTMLNTLDGVRDETGASPTSWAIWTRAWTAEENRGRVDMRQIEKTIQY
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           NKDITNKEPAELYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILE
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           LENLDENKLPGLGLFRELVNTCLSQPGLTTGQLLEHY---------------------RGTNNAATLEKL
1tmkA           ERSTRIGGLINEYLTD------------DSFQLSDQAIHLLFSANRWEIVDKIKKDLLEGKNIVMDRYV-
1bs2A1          ----------------------------------------------------------------------
2qgmA1          -------------------------------------------------------------SVQKNIVKS
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          -------TVTEIGKHAIDDSEKXIILGETATDTLKQHAVIQSFP--------------EKDQVTLAEGDH
1mm8A           ------------------------------------------LAKYSGKSITISSEGSKAAQEGAYRFIR
1es6A2          ----------------------------------------------------------------------
1vhhA           -----------------------------------------------------PLAYKQFIPNVAEKTLG
1j1zA2          ---------------------------------MDANLLHISYEGGVLEDPWAEPPKGMRMTQDPEEAPD
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ITDRLCFAYSRPKSASNVHYFSIELEYENFYADFGPLNLAMVYR------YCCKINKKLKSITMLR----
1f8xA           ----------------------------------------------------------------------
1ii8.1          AKDFTEELIEKVKKYKALAREAALSKIGELASEIFAEFT---------EGKYSEVVVRAEENKVRLFVVW
1f46A           GELLLNS-----IQQAGFIFGDMNIYRHLSPDGSGPA------------LFSLANMVKPGTFDPEMKDFT
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ------------------------------------------------ERLGYLGFAVKDVPAWDHFL--
1zs3A1          ------------ELDKAEIDHHKPTAGAHVLSNLFIEIRLTQAGI---------YAKSPVKCEYLREIAQ
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ------------------------------------------VWFRQDLRLHDNL----ALAAACRNSSA
1ni3A1          ----------------------------------------------------------------------
1f2t.1          -------------------------------------------------------EVVVRAEENKVRLFV
3cddA1          ---------------------------------------------------KTKAGVSLILGDNVKAARG
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          LRAMVASGSELGKKLK---------ATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEM
2vgmA3          ----------------------------------------------------------------------
2ancF1          QVLATGVDVFLDIDWQGQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYA
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           GKAALTVEPEFSPLDSGAFKLSREG---MVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSI-------IS
1a4iA2          ----------------------------------------------------------------------
1ckeA           SGAIRVLALAALHHHVD-VASEDALVPLASHLDVRLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREA
1tueA           NSTSHFWLEPLTDTKVAMLDDATTTCWTYFDTYMRNALDGNPISIDPLIQLKCPP---------------
1w1wA           AFYQKGNKLVELMRIISRNGDTSYKIDGKTVSYNENILIKAKFQGDVEQIAAQSPVELSRMFTFDYVSDH
1bccF           -------LEGIRKWYYNAAGNKYGLMRDTIYENDDVKEAIR----------RLPENLYDDRMFRIKRALD
2pa7A1          ----------------------------------------------------------------------
2fggA1          ---------------------------------------------------VGKTCQIDVL-------IE
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           RVLGASETIANIYTTQHRLDQGEISAGDAA-VVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLI
2je6I3          SEEILIEAIRKIENES------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ------------------------------------------------------------CGRYEGVDER
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          IFEHNN------KTELLSLIQDFIGSGGLIIPDQWEDDKDSVVGKQNVYLLDTSSSADIQLESADEPISH
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           IKDALAYAWGVFAANTDYPXLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDD-
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          GMPVDMASIDLERALNLLDEVTGRSFREDLLDTIF-----------------------------------
1iqrA2          ----------------------------------------------LRLHDHPALLEALARGP-------
1a82A           KPVASGSEKTPGLRNSDALALQRNSSLQLDYATVNPYTFAEPTSPHIISAQEGRPIESLVM---SAGLRA
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ------FNVGQYRRDMVKTYKSFEFFLLAALNDVRKFLSGHVAVFDATNTTRERRAMIFNFGEQNGY---
1eg7A           LREPSLGPSFGIKYAQVVPMEDINLHFTGDIHAVTYAHNLLAAMVDNHLQQGNVLNIDPRTITWRRVIDL
1qvrA2          GKRIVSLQMEFLKAVIQEVVQELRLIGATTLDEYRE--------IEKDPALERRFQDEPTVEETISILRG
1dwmA           ----------------------------------------------------------------------
1pujA           TPGILWPKFEDELVGLRLAV-TGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDA
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           LIA-------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           GVPITKVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVN---------KNEIMDALESVEVLDLK--
1pf4A1          GHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYT--------REQIEQAARQAHAMEFIEN
1yvuA2          ----------------------------------------------------------------------
1l7vC           GQPLEAWSATKLALHRAYLSQQQTPPFATPVWHY----------------LTLHQHDKTRTELLNDVAGA
1m3eA1          ----------------------------------------------------------------------
1poiA           GGDWDMLIGNGRVKAYITANSGVTNVSRRFRKWFEAGKL--TMEDYS----QDVIYMMWHAAALGLPFLP
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           TTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNY----------------YGSTVASVKQVS
1khbA1          IAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLASG-
1qhlA           KLKAGVCMLDTINSRVRLQQVAGRDRKVDIKPFAIQGL---PMSVQPTQLVTETLNERQARVLPLNELKD
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           DLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGC-------DFFPERWFHIVFVLRTD
1e9rA           DPNGDMLSKFGRDKDIILNPYDQRTKGWSFFNEIRND---------------YDWQRYALSVVPRGKTDE
1jalA1          VVPMPDPRLDALAEIVKPERILPTTMEFVDIAGLVAG-------------ASKGEGLGNKFLANIRETDA
1mukA           MVSVGPM-LQSTRKYFAQTLFMAKTVSGLDVN-----------AIDSALLRLRTLGADKKALTAQLLMVG
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           EVVAKD---SPLLSKIVEHFGAQILN--------------------------RAALRERVFNHDEDKLWL
1udwA           ----------------------------------------------------------------------
1pv4A3          VLLIDERPEEVTEXQR----------------LVKGEVVASTFDEPASRHVQ-------VAEXVIEKAKR
2hydA2          ----------------------------------------------------------------------
2yyeA2          MLALNDKARNLMLSLDATACTDVTGFG--LLGHAWNICKNSNIGARIF---FEKVPYYQLSENLVKKKIY
1urjA           ----------------------------------------------------------------------
2v3jA1          DISEARPDITHQCLLTLLDSPINKAGKLQVYIQTSRG--------------ILIEVNPTVRIPRTFKRFS
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          KILAAQLAAEFRELFPENAVEYFISYYDYYQPEAY-------------------VPGKDLYIEKDASINP
1jbkA           GRRVLALDMGALVAGAKYRGEFEERLKGVLNDLAKQEGNVILFI----------DELHTMVGAMDAGNML
2axpA1          ----------------------------------------------------------------------
1g6oA           DTEEIVFKHHK--NYTQLFFGGNITSADCLKSCLRXRP-------------DRIILGELRSSEAYDFYNV
1jqjA2          -------------------------------SEVEFTL---------PQATMKRLIEATQFSMAHQDVRY
1zp6A1          ----------------------------------------------------------------------
1vplA           GKNVVEEPHEVRKLI--------------SYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERAT
1kgdA           TTRPPEENGKNYYFVSHDQMMQDISNNEYLEYGSHED---------------------AMYGTKLETIRK
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           VYQQDEQTIVGAAPPILSHLLEIRGLGIIDVXNLFGAGAVRED-------------TTISLIVHLENWTP
1afrA           ----------------------------------------------------------------------
1g8yA           ---------------LQLAAQIAGGVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLL
1atrA1          TERLIGDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHKGETKSFYPEEVSSMVLTKMKEIAEAY
1tljA           --RITIVDAEMPWDRKNSTIIFKNHLRITEQDLEDV-----LSKNQVRRLWLIVQGPIIHIYAKNIETGW
1cd5A           EEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVM
1qhdA1          GMNWTDLIT--NYSPSREDNLQRVFTVASIRSML------------------------------------
1iioA           -------------------------------SHMKMGV--------KEDI-RGQIIGALAGASPEELMAA
1n25A           NFELGVAIDQFLVV-FEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSV-KVNLEKKHLNKRTQIFPPGI
1ckvA           ANGKIEVDCDEISELLGRQFNVYDFLVDVSSTIGRAY------------TLGNKFTITSELMGLDRKL--
1g6hA           ----------------------------------------------------------------------
1s9hA           E----NFPFNDCVDKMVIWWEEGKMTAKVV-ESAKAILGGSKVRVDQKCKSSAQIDPTPVIVTSNTNMC-
1xbtA1          KAKDTRALPACLLRDVAQEALGVAVIGIDEGQFFP----------------------DIVEFCEAMANAG
1viaA           IEQKFNQKVSEIFEQKRENFFREQEQKXADFFSSCEKACIATGG-GFVNVSNLEKAGFCIYLKADFEYLK
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           LMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFD----------LGLYNEAVKIIHD------
1l7lA           REHPDQGLICH-DAFCGALVMKIGN---SGTIPVNTGLFRWV------APNNVQGAITLIYNDVPGTYGN
1d6jA           LDGDNIRFGLNKDLGF----------------------SEADRNENIRRIAEVAKLFADSNSIAITSFIS
1fl9A           YTLVE----EYNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDY
1pgsA2          NANTFQHQLGALGCSANPINNQSPGNWTPDRAGWCPG---------MAVPTRIDVLNNSLTGSTFSYEYK
1lw7A2          EFVFEKLGGDEQAMQYSDYPQXA-------------------------LGHQRYIDYAVRHSHKIAFID-
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------SFHPKLRPILLP------------NKNSADLTSPEKIQAIMT
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------SYGGAVGYFTAHGLDTCIVIRSALVENG----------IATVQAGAGIVLDSVPQSEADE
1zbsA1          ---------------------------------------------------------SNSCLFDGREIKA
1jqjA3          GAEMIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQI-------------------EDAASQSAAYVVM-
1e3mA2          AQKVEIGPIDRIFTRV--------GFXVEXTETANILHNATEYSLVLXDEIGRGT----STYDGLSLAWA
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           --------------------------------------------------VLAKIVNYMKTR--HQRGDT
3cddA2          ITGYVDDWVPSYDEST---------ITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIK
1v47A1          ----------------------------------------------------------------------
1cr0A           ----KKVGLAMLEESVEETAEDLIGLHNRV-------------RLRQSDSLKREIIENGKFDQWFDELFG
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           -------------------------WPEHRRVELITTDGFLHPNQVLKERGLXKKKGFPESYDXHRLVKF
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          TIDPEEAKVAVPDERFDWLCEAYKPKSRVPAFLTVFDIAGLTKGASTGVGLGNAFLSHVRAVDAIYQVVR
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           KHTHHELRKAGAAQTIVASQQRWALMTETPD-----------------------------EEELDLQFLA
1ovmA2          GAPGTAAQ--QRGELLHHTLGDGEFRFYHMSEPITVAQ-----AVLTEQNACYEIDRVLTTMLRERRPLM
1mi8A           TIDGWKRLDELSLKEHIALPRKSISWDSIVSITETGVE------EVFDLTVPGPHNFVANDIIVHASI--
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ---------------------------------------------------IHDIEHLANAFSLPTPEIX
2gtlM1          CDFNLGDDDCKIVVPSLFVCAHFNAQ--------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          GSWQRCVSSCQAALRQ---------GKRVVIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHN
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          LDTGKELPYEPSIDVREFVTVEEIMREGYGPNGA----IVESYDRLMEKFNEYLNKILRLEKENDYVLID
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------EALPTLLEEF-------------LNEVEKMLKNQVNTRRIHQ
2vnuD1          ----------------------------------------------------------------------
1odfA           --------YNHLMEKYGGEKSIGYASIDDFYLTHEDQLKLNEQFKNNKLLQGRGLPGTHDMKLLQEVLNT
1g8fA3          ----------------------------------------------------------------------
1b77A2          GYNKVEDS-GLTRPKYSLTLTDYDGSNNFNFVINMANMIQPGNYKVMLWGAGDKVAAKFESSQVSYVIAM
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          TPGFSSLEFTDIEEELGYTFPDIREKSSCKFRGCL-------HLKEPKCAVKQAVEKQYRYDHYVEFMTE
1oa8A           ---------------------------------------------TEDFIQSAEISNDLKIDSSTVERIE
1dekA           ----------------------------------------------------------------------
1l8qA2          ADDFAQAXVEHLKKGTINEFRNX-------YKSVDLLLLDDVQFLSGKERTQIEFFHIFASDRHPQKLDG
1mkyA1          TFKLVDTCGVFDNPQDIISQKXKEVTLNXIREADLVLFVVDGKRGITKE--DESLADFLRKSTVDTILVA
1f48A2          TSDPAAHLNNLQVSRI------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           LPEKYETHVGERGFLLSGGQKQRIAIARAIVSDPKILLLDEATSALDTKSEGVVQAALDEASKGRTTIII
1e69A           ISIRKPGRRDQKLSLLSGGEKALVGLALLFAKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHTQFIVI
1b0uA           IDERAQG---KYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQAEEGKTMVVV
1q3hA           FAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTILV
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          IEGKVDAFVGIDISRITRDGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGD-------VFS
1l7vC           ----------------------------------------------------------------------
1m3eA1          TSTGYGTLVQEGGSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKADQAGNVTFRKS
1poiA           ----------------------------------------------------------------------
1ji0A           LFPRLKERLKQLGGTLSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILL
1nijA1          ----IECTGMADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQVGY--ADRILLTK
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           SESNIAQDVADKWIASGDELKMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHSPTKSAMNNFLNTV
2iqhA1          E---DLIFLARSALILRGSVAHKSCLPACVYGSAVASGYDFEREGYSLVGI-----DPFRLLQNSQVYSL
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           VFLGGAAAQERWRSFVGDLDVLWVGV------RCDGAVAEGRETARGDRVAGMAAKQAYVVHEEYDVEVD
1bmfA3          DNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLQAGDVSA
2gk3A1          AHTVQ----IAFPESIDELNRYDVIVISDIGSNTFLLQNETFYQLKIKPNALESIKEYVKNGGGLLXIGG
1mjgM           NINWLRVSKDAVAKGFRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREERDDRMRGLT
1jjvA           ----------------------------------------------------------------------
1udwA           TVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFE
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           NGAALPADITFTAFAGGFEQRLASVMAGDAALASMAVFDEPPTDISAQDTAAARANAVGAYLARAAGLVG
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ILVDTAGR-----------LQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEGVTGLVL
2gx8A1          SLDVK-------GARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVTGDMYYHVAHDAMMLGLNIVDP
1o7d.2          --------------VYNPLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLFSALVPAV
1bgxT2          DAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELDLLGLARLEVPEADDVLASLAKKAEKEGYEVRIL
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          LHADPSVRLRVRGYIEGKDIDSILELYREVXSNAGLHTYSWDTGQWSSDIAKDIIFLVE-----------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ARPLHYIVLRTTAAEAIERCLDRGG--DSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAIN
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           KLVSLQQEIAQQGGIVMDGR----DIGTVVLPQAELKIF------LVASVDERAERRYKENIAKGIETDL
1e6cA           -LALRLQASLQAHQRPTLTGRPIAEEMEAVLREREALYQDVAHYVVDAPPAAIVCELMQ-----------
1jb1A           ----------------------------------------------------------------------
1afrA           LIGSGMDPRTENSPYLGFIYTSFQERATFISHGNTARQAKEHGDIKLAQICGTIAAD-----EKRHETAY
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           FL-KLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLHDIFNHVLELKAKGITFLII
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           SXWDDIADKNIAEQTFTDSLNHXFDSLLEL--RQEELIARERTHGLSNEERLELWTLNQELAK-------
1tmkA           ----YSGVAYSAAKGTNGMDLDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQ------EKVKQTFMK
1bs2A1          ---------------LRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTV
2qgmA1          IQSQANPLKTI----EPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFA
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          LKIGDTNYTITKVGSFANSNLQSIAHSTLIFADAPTDEDDVIRNGVYLTPH-----QLPKITIGTTIDYL
1mm8A           NPNVSAEAI------RKAGAMQTVKLAQ----EFPELLAIEDTTSLSYRHQVAEELGKLGSIQDKSRGWW
1es6A2          ----------------------------------------------------------------------
1vhhA           ASGRYEGKI------TRNSERFKELTPNY---NPDIIFKDEENTGADRLMTQRCKDKLNANQWPGVKLRV
1j1zA2          APEYVEVEFFEGPVAVNGERLSPAALLQ----RLNEIGGRHGVGRVDIVENRFVGMKSRGVYETGTILYH
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          --KKIVHF-------TGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSAAYGSCNFYITLLDC
1f8xA           ----------------------------------------------------------------------
1ii8.1          EGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLTIMERYLKKIPQVILV
1f46A           TPGVTIFMQVPSYGDELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIRE----------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ---------------------PALEIGEDERLDL-ENLATGAFFPVKGFMTREEALSVAHPTGEVWTIPI
1cr0A           ----------------------------------------------------------------------
1dhyA1          ---------TKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAARMADKLRQAGVA
1zs3A1          REVEYFFKISDL----LLDENEIVPSTTEEFLKYHKFITEDPKAKYWTDEDLLESFIVDFQAQNTRAIKL
1esmA           ----------------------------------------------------------------------
1sbxA           ---------------RSTERCETVTISCFVVGGEKRLCLPQILNSVLRDFSLQQINAVCD-ELHIYCSRC
1dnpA2          RVLALYIATPRQWATHNMSPRQAELINAQNGLQIALAEKGIPLLFREVDDFVASVEIVKQAENSVTHLFY
1ni3A1          ----------------------------------------------------------------------
1f2t.1          VWEGKERPLTF----LSGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERLKKIPQVILV
3cddA1          RFSWRQRFSKF----TIKAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKSNXAEYTVT
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          LDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAI
2vgmA3          VMDEFLLHLNKDDDKAWYGE-KEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSESNGGKALVL
2ancF1          EYDYLIVNDDFDTA---LTDLKTIIRAERLRMSRQKQRHDALISKLL-----------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           LGTK---DSCEFFHDPNKGRSDEGRVRKVLKVEPL---PDGSGHFFNLSVQNKLINLDENIYI----PVT
1a4iA2          ----------------------------------------------------------------------
1ckeA           LLRRQRAFRELPGLIADGRDM-----------GTVVFPDAPVKIFLDASSEERAHRRMLQQVKGFSVNFL
1tueA           ----------------------------------------------------------------------
1w1wA           LDAIYRELTGNDMEYLSGGEKTVAALALLFYQPSPFFVLDEVDAALDITNVQRIAAYIRHRNPDLQFIVI
1bccF           LNMR-------QQILPKEQWTKYEEDVPYLEPYLKEVI--------------------------------
2pa7A1          RGFHAHKKLEQVLVCLNGSCRVILDDGNI----IQEITLDSPAVGLYVG-PAVWHEMHDFSSDCVMMVLA
2fggA1          EHDERTRAKAR----LSWAGRQXVGVGLARLDPA-----DEPVAQIGDELA--IARALSD--LANQLFAL
1yj5A2          ----------------------------------------------------------------------
1uouA3          -----------------------------------------------REQEELLAPADGTLVRALPLALV
1e2hA           FDRHPIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLARPGERLDLAMLA
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           VKKIVDMEISLGDFILSGGEIVALAVIDAVSRVLPGVLSEPYP---------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          IVQK------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           --------------------------LPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRGEVPELCVVH
1em8A           -------------------------------KNATFYLLDNDTTVDGLSAVEQLVCEIAAWRSGKRVLIA
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           -----EGKESVNFVAFNKITDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDY---------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ------------NRRKYMNPNYELKKLREIPDEDIVRLMGHREPGEEYP---SVHPPLEEMEEPECPI--
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----VVGLVVLDPNNLKTTPRRRAWFLENVRA------LREAYRARGGALWVLEGLPWEKVPEKAKAVYA
1a82A           LEQQADWVLVEGAGGWFTPLSDTFTFADTQEQLPVILVVGVKLGCIN-----------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           NERAL-----------------------------------------------------------------
1qvrA2          LKEKYEVHHG------------------------------------------------------------
1dwmA           ----------------------------------------------------AAATVERENRNVHAIVLK
1pujA           IGEK-------RGCLMSGGLINYDKTTEVIIRD-------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------KKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVII
1pf4A1          MPQGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVI
1yvuA2          ----------------------------------------------------------------------
1l7vC           L--ALDDKLGRSTNQLSGGEWQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKILSACQQGLAIVXS
1m3eA1          ----------------------------------------------------------------------
1poiA           VTLMQGSGLTDEWGISKEVRKTLDKVPDDKFKYIDNPFKPQVDVAISPDGTVRIWGGVDIAEAAKYTIVT
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           KSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAEHDKVIV
1khbA1          ----------VTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAG
1qhlA           KLEAMEGVQFKQFNSITDYHSLMFDLLRSASDRSKFYRLIEASGGISSAITRSLRDYL------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           TNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIK
1e9rA           AEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEKALTSARFVL
1jalA1          IGHVVRCFENIDPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMI
1mukA           LQESEADALAGK---IMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRH--------LN
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           NNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANFEQIQRIMNSQ
1udwA           ----------------------------------------------------------------------
1pv4A3          LVEHKKDVIILLDSITRLARAYNTVVPAVLTGGVDANALHRPKRFFGAARNVEEG---GSLTIIATALID
2hydA2          ----------------------------------------------------------------------
2yyeA2          PKGAIENLNFVKNYLKSNLDNWKLILLSDPVTSGGLLFTINKEKLEK------IDETAKELEVNYWIIGE
1urjA           ----------------------------------------------------------------------
2v3jA1          GLXVQLLHKLSIRSEEKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDDESICVFVGAXAR
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          EIERLRTRRDVIVVASVSAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFE
1jbkA           KPALARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVAEPSVEDTIA---------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           LCSGHKGTLTTLHAGSSEEAFIRLASNSAARNIKFESLIEGFKDLID-----------------XIVHIN
1jqjA2          YLNGMLFETEGEELRTVATDGHRLAVCSMPIGQS----LPSHSVIVPRKGVIELMRMLD-GGDNPLRVQI
1zp6A1          ----------------------------------------------------------------------
1vplA           EIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTVSS
1kgdA           IHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTII
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           DQLIFDVPVPKITVPVKVGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLIE---------------
1afrA           ----------------------------------------------------------------------
1g8yA           IQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIGRMEAIAADTGCSIVFL
1atrA1          LGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGL-------------------
1tljA           DILKIAREAGFKHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKKTLVNVCNEVLARGKQKMNL
1cd5A           ILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEA----------
1qhdA1          ----------------------------------------------------------------------
1iioA           LPNGPDTTCKSGDVELKASDAGQVLTADDFPKSAEEVADTIVNKA-------------------------
1n25A           VTMNEYSVPKT----LQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPEFAQSIQ
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           --------------AVIDGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKTKQEVKDFFRWAKDHVVEVEH
1xbtA1          KTVIVAALDGTFQRKPFGAILNLVPLAESVVKL-------------------------------------
1viaA           KRLDKDEISKRPLFYDEIKAKKLYNERLSKYEQKANFILNIENKNIDELLSEIKKV--------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           FPQFYPLGI-------------------------------------------------------------
1l7lA           NSGSFSVNIGK-----------------------------------------------------------
1d6jA           PYRKDRDTARQLHEVATPGEETGLPFVEVYVDVPVEAPYEAPANPNYELPVQDAVKQIIDYLD-TKGYLP
1fl9A           YDDA-------RNIELIAQTNLGKNIISAF----------------------------------------
1pgsA2          F----QSWTNNGTNGDAFYA--------------------------------------------------
1lw7A2          ----TDFITTQAFCIQYEGKAHPFLDSXIKEYPFDVTILLKNNTEQKQRQQQLLKKLLDKSYLDRYNQVK
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          SLQDFKIVPIDPTKNIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQCDTCHSPASL
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           TRNKA------------RAVLRAIATAH------------------------------------------
1zbsA1          NVSPLGYILGDEGSGAVLGRLFIGSLLKGQ---XPEGLCEAFLQEYGLTSADIIESVYRKPFPNRFLAGF
1jqjA3          ----------------------------------------------------------------------
1e3mA2          CAENLANKIKALTLFATHYFELTQLPEKALEHGDTIAFXHSVQDGAASKSYGLAVA--ALAGVPKEVIKR
1ohcA1          ----------------------------------------------------------------------
1f8xA           --------IYFGAGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIREHPEYLHDKVWATATY
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           HPLTLDE-ILDETQHLDIGLKQKQWLMEALVNNPKIEVIDGKYAFKPKYNV-------------------
3cddA2          VIVNTDVGEPFQRIQIEQGETPHELLARLAK-QRGVLLTSDTFGNLV-----------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           NDTF---HLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHIS--IRKMIDNLMTKLKGFAKSTGVVLVV
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           VSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSVDA
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          AFDDAE---------IIHVEGDVDPIRDLSIIVDELLIKDA-----------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           SRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVP--LNLDVALLDINDVEGL
1ovmA2          LPADVAKKAAT-----------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          VRFYLXRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESE-----------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ---------------------------------PAEILNGKE---ISAQIRARLKNQVTQLKEGFTPRLA
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          NRFREXTDPSHAPVSDXVXFSYRKQFEPPTLAEGFLEILEIPFRLQEHLDP-ALQRLYRQFSEG------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          TPGQMETFLFHEFGVRLMENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTIPALNKVDLLS
1oy5A           ----------------------------------------------------------------------
1gm5A1          LLKELDDPLLENK-DLEEKLQAFLDYVKEIPN------LPEARKRYRIQKSLEMIEKL--RSWFLIDYL-
2vnuD1          ----------------------------------------------------------------------
1odfA           IFNQDTVVLPKYDKSQFKGEGDRCPTGQKIKLPVDIFILE------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          EA--------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          IKDRKPRY--------------------------------------------------------------
1oa8A           DSHSP----GVAVIQFAVGEHRAQVSVEVLVEYP-FFVFGQGWSSCCERTSQLFDLPCSKLSVGDVCISL
1dekA           ----------------------------------------------------------------------
1l8qA2          VSDRLVSRFEGGILVIELDNKTRFKIIKEKLKEFNLELRKEVIDYLLENTKNV-----------------
1mkyA1          NKAE-----------NLREFEREVKPELYSLGFGEPI----PVSAEH-----------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           AHRLSTIKTADNIVVLVDGRIVEQGTHDELVERDGTYLRLVEAQRINEERDAQAMADSDDGEESPMGSDA
1e69A           THNKIVMEAADLLHGVTMVNGVSAIVPVEV----------------------------------------
1b0uA           THEMGFARHSSHVIFLHQGKIEEEGDPEQVFGNPQSRLQQFLKGSLKK----------------------
1q3hA           TSKMEHLRKADKILILHQGSSYFYGTFSELQSLRPDFSSKLMGYDTFDQFTEE-----------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          LLEKLGFKKGSKIVVHRDGRLYRDEVAAKYGELYGYSLELLEIIK-------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ARNFNLPCKAAETTVVEVEEIVDIGSAPEDIHIPKIYVRLVKGEK-------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           VNALGALKVAHYGYVLETGQIVLEGKASELLDNE------------------------------------
1nijA1          TDVAGEAKLHERLARINARAPVYTVTHGDIDLGLNTNGFMLEENVVSTKPRFHFIAD-------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           AISYVAVEIAKEVGIVEVKRDNKKSSLLNASES---IQKELDRGRLGFKRK-------------------
2iqhA1          IRPNENPAHSQLVWMACHSAAFEDLRVSSFIRGTKVVPRGKLSTRGVQIASNE-NMETMESSTLELRSRY
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           TTHKESIECAWAIA--------------------------------------------------------
1bmfA3          YIPTNVISITDGQIFL-ETELFYKGIRPAINVGLSVSRVGSAAQ--------------------------
2gk3A1          YLSFXGIEAKANYKNTVLAEVLPVIXLDGDDRVEKPE---------------------------------
1mjgM           DETVDTFYAPNHVCIVTPERVGLCGAVSWLDAKASYEINHAGPNQPIPKEGE------------------
1jjvA           ----------------------------------------------------------------------
1udwA           EFCLPTKKYADVIIPRGADNLVA---INLIVQH-------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           AMVFSTNSALHLTEV-------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          TKLDGDARAALSARHVTGKPIYFAGLEPFYPER-------------------------------------
2gx8A1          GHNVEKVGVQKQLQEKVDAKKLNVHIHASQLHTDPIFV--------------------------------
1o7d.2          GFSIYSVSQMPRDLVIQNERFDPNTGLLPVRQAFYWYNASTGNNLSSQASGAYIF--RPNQNKPLF----
1bgxT2          TADKDLYLLSDRIHVLHPEGYLI--TPAWLWEKYG-----------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ALQ-------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ETLKKEIAARD-----------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           TKIVEKLFEDPDGTVLAFADMMRKKISMPAHLMYDGR---------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           EHRLDIVNYIDHLYVMFNGQIIAEGRGEEEIKNVLSDPKVVEI---------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           LLDKEIRKGDESITIVDVTNKGIQEVEALIWQIVEPVLTHIDHDKFS-----------------------
1bs2A1          VTYLFKL-THQVSSCYDVLWVAGQTEELATARL-------------------------------------
2qgmA1          XEEDWGNGLKLNEYIQTGKGNPREFLKLLYPTDEIIA---------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           VHSVLLLATTFRTVGLLHQEWWMRPDDPADADEKESG---------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           TEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDSKAHIHCSVKAENS---------
1j1zA2          ARRAVESLTDREVLHQRDMLSPKYAELVYYGFWYAPEREALQAY--------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          FH--------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          SHDEELKDAADHVIRISLENGSSKV---------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          LLQFRRVGPGNTVALLHGGERVALLHVAEAYELD------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          FTRGDEALMQQRKVMGLLCLQDPFGLPLEIYYG-------------------------------------
1zs3A1          ANKEEKFALAAGVVELYGY---------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           TADQLEILKVXGPFSAPSCGLITKTDAERLCNA-------------------------------------
1dnpA2          NYQYEVNERRDVEVERALRNVVCEGFDDSVILPPGAVMTGNHEMYKVFTPFKNAWLKRLREGMPECVAAP
1ni3A1          ----------------------------------------------------------------------
1f2t.1          SHDEELKDAADHVIRIS----LENGSS-------------------------------------------
3cddA1          GWRIPQTGKLWNINTLV--PVIDEIXG----LDEEXLIASILFSEDDAGRLAVISVVRPDAXD-------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          DASQTPDVVFASILAAFS----------------------------------------------------
2vgmA3          STLHSLGEELDQIACILKYPLPD-----------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           KAEFAVLVSANFVMPYLLGWHTAVNSF-------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           LAEIKLVPAADALVLDSTTLSIEQ-VIEKALQ--------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           SLKNTMFEKSDALV--------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          SDYYDETDYRQYDNFKKYIAKI------------------------------------------------
2fggA1          TSSDIEAST-------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          LHELGALRLVGAELLVDVGQRLRRGTPWLRVHRDGPALSGPQSRALQE----------------------
1e2hA           AIRRVYGLLANTVRYLQCGGSWREDWGQLSGPRPHIGDTLFTLFRAPE----------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           SV---GPDVPEGFCEVGDLTSLPVGQIRNVPHPFVALKQPKEIKQKFVTCHYKAI---------------
1em8A           CEDEKQAYRDEALWARPAESFVPHNLAGE-----------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ---LDKFNSGYDYYIVPDTR--QDHEMDAARAMGAT---VIHVVR--PGQKSNDTHITEAG---------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           -RELVEPTEGAKAGDRIRYIQFTDSVYFAPIHPYIRARMYMWRYRGVDTGSLSGRQIIEVRERDLEKIA-
1xzpA1          ----------------------------------------------------------------------
1iqrA2          LTSHTPYRYRDGRVR-------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           EGSAMTKDFCDRVWVIVNDHGVVTSV--------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           SSR-EELSYCDVNENLHKY---------------------------------------------------
1pf4A1          AHRLSTIEQADEILVVDEGEIIERGRHAD-----------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           SHDLNTLRHAHRAWLLKGGKXLASGRREEVLTP-------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           CEEIEIRRDPTKNDICVD-AVVLAGAHYGLYDYDNPFLKVYDKVSKTQEDFDAFC------KEWVFDLKD
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           NDDLDKAKELKDFIFA------------------------------------------------------
1khbA1          VPLVYEALSWQHGVFVGAAMRSEAKIIMHDPFA-------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           DH--------------------------------------------------------------------
1e9rA           SDKLPHVTMPDGDFSIRSWLEDPNGGNLFITWREDMGPALRPLISAWVDVVCTSILSLPEEPKRRLASLA
1jalA1          GLDKEELQAIKSYNFLTLKPTMYIANVNEDGFENNPYLDRVREI-AAKEGAVVVPVCAAIESEIAELDDE
1mukA           TDIPPRMGWRAILRFLGAGMVMTATAVDIYLE--------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           VSQQERLKWADDVINNDAELAQNLPHLQQKVLEHQFYLQQAENK--------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          TGSKXDEVIYEEFKGTGNXELHLSRKIAEKRVF-------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          T-------IAENVLEVL-----------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          GKDNFADEYVDEKVGLSNYPLSASVACSKFCH--------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ER--------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           HHKQCDE---------------------------------------------------------------
1jqjA2          GSNNIRAHVGDFIFTLVDGR--------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           HNMLEVEFLCDRIALIHNGTIVETGTVEELKERYKAQ---------------------------------
1kgdA           NNEIDETRHLEEAVELV-----------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           HHLVDNIRWQSYLSSMTSAEAEEWGVDDDQRRFFVRFGVSKANYGAPFADRWFRRHD-------------
1atrA1          ----------------------------------------------------------------------
1tljA           LKD-------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           SRIVEWKRLDKEFSLSVYQKMKF-----NVAMGIGVL---------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           EFYV------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           AKK-------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          AV-IEKVLNEEEISELQ-----------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          SPFIAQHLDIPAVYSLVQNSFDDFLVRNVRYNRPDLPLHFIGSVAFREVLSSVI----------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ARQKL-----------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           NNDLNGIKTNDIMLGVYIPDEEDVGLGMELGYALSQGVLLVIPDEDYGKPINLMSWGVSDNVIK------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ICHLKDLRASDTIIALERNQLVL-----------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           PEDLLQTWYINRFLKFREGAFTDPDSYFH-----------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ADFVVEWM--------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSI
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          EEEKERHRKYFEDIDYLTARLKLDPSMQGLMAY-------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           TLK-------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           DALRLQKSITAASNASARFADEKMDLELQKTETKKSLSSVILSKREPEKDKEYGLGTLIKFISSFNAAEW
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          WAIRTR----SGGNTSSGQISIQPTFSVQRNLPFDRPTIMAASDMRTE----------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          KVRSSG---SIEPSPSITLNYPRQSFD-------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           HDEYLNK----------LGATRLINLK-------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           DALT-----KGRKAGLQSTSQLDDVYGVKEAQTLRASFRSLVVLGGSRTDPKTSLGEEVERDRALERVRE
1jalA1          EKVEFLQDL-------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ---------------------------------------------------------TFKRLWTYIRLYK
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          NTEEVINAI-------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           KLMVTGLAVSIICGAGQPTMAVFFSKCISALALPPPLYDKLRSDANFWCLMFLMLGIVMFFAYSIQGSLF
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           RVVMPAEIANL--PDLT--AYVGFA------GNRPIAKVPLE----------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          -------------------------------------------------IALFIFVIVRPPIEFIRQYLA
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          AGLVVSTIALVINAAADTYMISLLKPLLDEG-----FGNAESNFLRILPFMILGLMFVRGLSGFASSYCL
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           AYCSEKLIYRARSKAFRSMLRQDIAFFDVDENSTGALTSFLSTETKHLSGISGVTLGTILMVTTTLAASM
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          QWTSNKILYDIRKKLYNHLQALSARFY--ANNQVGQVISRVINDVEQTKDFILTGLMNIWLDCITIIIAL
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          SWVSGNVVMQMRRRLFNHFMHMPVRFF--DQESTGGLLSRITYDSEQVAGATSRALVSIVREGASIIGLL
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           VVGLAIGWKLALVCISCVPVLLACGFYRFWILAAFQRRXXXXXXXXXXXXXXXXXXIRTVASLTREPDVS
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          --------------------------------------------------------MDVLYSLSKT----
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          SIMFFLDVKLTLAALFIFPFYILTVYVFFGRLRKLTRERSQALAEVQGFLHERVQGISVVKSFAIEDNEA
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          TLMFWNSWQLSLVLIVVAPV-----------------------------------VAFAISFVSKRFRKI
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           GTYHGQLVVQGKKSLVSILKSSTLYAASQSFMFFVLALGFWYGGTLLGKGEYTLFQFFLAFSEVIFGAQS
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           -------------------------QALSDYLMQNPELK-----SRVLRGRSE---------WEKYGAGI
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ------LKDARDKIVEGTLYSNVSDLIQQFNQMIITMNGNEFTGGIGNLPIRNWNFDFGLLGTTLLNLDA
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1jmu.1          -----VVVTEHAIANFTKAEMALEFNREFLDKLKYSDL-LTYVDCYVGVSARQALNNFQKQVPVITPTR-
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ----------------------------------------------------------------------
1l7vC           ----------------------------------------------------------------------
1m3eA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ------------------------------------------------EIRASVGKMIDGIGRFYIQMCT
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          KNFDKKNTNFLTRALKHTRWNAYSFAAINTVTDIGPIIVIGVGAYLAISGSITVGTLAAFVGYLELLFGP
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          SRNMQTAMGHRQQTMKLVSAQSIADPVIQMIASLALFAVLFLASVDSIRAELTPGTFTVVFSAMFGLMRP
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           AGTVFSFAPDMGKAKSAAADFKKLFDRRPPIDTLSKEGDDVEHIEGTIEFRDVHFRYPTRPEQPVLRGLN
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           -----------------------------------------------LEIRDLSVGYD----KPVLERIT
1pf4A1          -----------------------LMDLETERDNGKYE---AERVNGEVDVKDVTFTYQGK-EKPALSHVS
1yvuA2          ----------------------------------------------------------------------
1l7vC           ------------------------------------------------QLQDVA-------ESTRLGPLS
1m3eA1          ----------------------------------------------------------------------
1poiA           ---------------------------------------------------------------TLKDAIA
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ------------------------------------------------------------AEHMLVLGIT
1qhlA           -----------------------------------------------GKFRSLTLINWN-----GFFART
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           ----------------------------------------------------------------------
1e9rA           -----------------------------------------TRIVSGGKLKRMTREKAKQV---TVAGVP
1jalA1          ----------------------------------------------------------------------
1mukA           IHNPPSLFDVPHKWYQGAQEAAI-----ATREELAEMDETL-------------MRARRHSYSSFSKLLE
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          -----------------------------------------------ILFENLTPLHANSRLRARVLDLA
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          ------------------------------------------------------------PQAP--PVLT
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------TFRYRGPSPKGD---QPKAIAGLV
1jbkA           ---------------------------------------KKYTIDLTERAEQGKLDPVIG-RDEEIRRTV
2axpA1          ----------------------------------------------------------------------
1g6oA           ------------ANGERVQIVLSPVTVNDETISISIRIPSKTTYPHSFFEEQGFYNLL-DNKEQAISAIK
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ---------------------------------------------GAVVVKDLRKRIGKKE---ILKGIS
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           -------------------------------------------------------------ERRSXHGVL
1afrA           ----------------------------------------------------------------------
1g8yA           ----------------------------------------------THKPINILEAFAA--APPPLDYVL
1atrA1          ------------------------------------------------------------------KGPA
1tljA           ----------------------------------------------------LVWEEL---REKALNKIY
1cd5A           -----------------------------------------MHKAGQVSFKHVVTFNM--DEYVGLPKEH
1qhdA1          NYVETAR---NTIDYFVDFVDNVCMDEMVRESQRNGIAPQSDSLIKLSGIKFKRINFDNSS--EYIENWN
1iioA           ----------------------------------------------------------------------
1n25A           --------------------------------------------------------------------MV
1ckvA           -----------------------------------------------AYDAGIMGLKGKDFADQFFADEN
1g6hA           ----------------------------------------------------------------------
1s9hA           -----AASNSRSQIKAALDNAGKIMSLTKTAPDYLVGQQPVEDISSNYKILELNGYDPQYAASVFLGWAT
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ---------------------------------------------------DMMDLP-----RSRINAGM
1l7lA           --------------------------------------------------------------------VL
1d6jA           ---------------------------------------------------------------TRSERTE
1fl9A           -----------------------------------------ESLTQYIPDEFSMLRFGKKF---AEILLK
1pgsA2          --------------------------------------------YNKSSIDGVPYGKAHTLGLKKNIQLP
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ------ELDMRTDHKELSEHLMLVDLARNDLARICTPGSYVADLTKVDRYSYVMHLVSRV-VGELRHDLD
1zbsA1          ----------------------------------------------------------------------
1jqjA3          -----------------------------------------KNPDKHLEAGCDLLKQAAAASNEKFRGVR
1e3mA2          --------------------------------------------KPGIRITEGRHPVVEQVNEPFIANPL
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------VLKAGGKIYQGWTKIITRSLEAXS
1v47A1          ----------------------------------------------------------------------
1cr0A           -----------------------------------------ERIREHLSSEESVGLLFSG--CTGINDKT
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------DRNQWAALRDSVPXTLSED-EIARLKGINEDLSLEEVAEIYLPRQAVLEQFLGT
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ------------------------------------------------------------------KVQW
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ------------------------------LDRLTDCG--ADHLDHVIDSPDICWVGC-ANELNASYAAD
1mi8A           --------------------------------------------GKRVSIKDLLDEKDFEI--WAINEQT
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          -----------------------------------------------TITAAHRKSFFPRVWLRATLSYE
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          -----------------------------------------------IRTRRAAELLDKRIVSIDSWPTT
1jmu.1          -QTMYVDSIQAALKALE------------KWEIDLRVAQTLLPTNVPIGEVSCPMQSVVKLLDDQLPDDS
1odfA           -------------------------------------------------------------DKYIPEWFE
1g8fA3          ----------------------------------------------------------------------
1b77A2          -----------------------------------------------------------------VASVI
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          -------------------------------------------------RNIGYDVYLTSSKDQDSLADI
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------VKEALE
1mkyA1          ----------------------------------------------------------------------
1f48A2          -----------------------------------------------------------RPDIPSLSALD
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          --------------------------------------------------------------------PP
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           ----------------------------------------------------------------SFGRPS
1b0uA           -----------------------------------------------LHVIDLHKRYGGHE---VLKGVS
1q3hA           -----------------------------------------------EKVSFSHLCLV---GNPVLKNIN
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          ------------------------------------------------------------------KGIK
1l7vC           ----------------------------------------------------------------------
1m3eA1          ---------------------------------------------------------------TDAVEAV
1poiA           ----------------------------------------------------------------------
1ji0A           -----------------------------------------------LEVQSLHVYYGAIH---AIKGID
1nijA1          ----------------------------------------------------------------------
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           -----------------------------------------------------------------VMQEL
2iqhA1          ELKLSDEGRLIQNSLTIERMVLSAFDTGGPIYRRVDGKWRRELILDKEEIRRIWRQANNGDTHMMIWHSN
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
1bmfA3          ---------DVPVGEELLGRVVDALGNAIDGKGPIGSKAVGLKAPGIIPRISVREPMQTGI---KAVDSL
2gk3A1          ----------------------------------------------------------------------
1mjgM           -----------------------------------------------IKLTKIKLDLP---INFGPAFEG
1jjvA           ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1pv4A3          ----------------------------------------------------------------------
2hydA2          LRRLVASFTTLTQSFASMDRVFQLIDEDY-----------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           --TPSHYSSRHLDPSTQAPNLTRLCERARRHFGFSDYTPRPGDLKHETTGEALCERLGLDPDRAVTEGFK
2v3jA1          ----------------------------------------------------------------------
1ffhA2          --------------------------------------------------------------------RL
2gx8A1          ----------------------------------------LGLQNTEVLAPTYAEEMKKVVVFVPVTHAE
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           ----------------------------------------------------------------------
1afrA           ------------------------------------------------------------PPREVHVQVT
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           -----------------------------------------------LRTENIVKYFG---EFKALDGVS
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          LKALTSVTSEFQRGMAAC---QTLF---------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          SDTVVEFKEGIGSGKSSLLDYWPLRIKDIKKDEFTKVGARDTYIDLIFEKDGTKYRITRRFLKGEIHAMK
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ------------------------------------EGGDWRPIVQFLRYQQIEFIT----FLGALKSFL
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          -------------------------------------------------------------------GIV
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          --------------------------------------------------------------EKLTEELK
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           LSVKPGQYVALVGPSGCGKSTTIALLERFYDTLSGGVYVDGTDITRWNVSAYRSFLALVSQEPTLYQGSI
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           MTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKVKGKIFFLPEEIIVPRKISVEDYL
1pf4A1          FSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDYKLTNLRRHFALVSQNVHLFNDTI
1yvuA2          ----------------------------------------------------------------------
1l7vC           GEVRAGEILHLVGPNGAGKSTLLARXAGXTSG-KGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATP
1m3eA1          ----------------------------------------------------------------------
1poiA           KYVHSGDHIALGGFTTDRKPYAFEILRQGITDLTGLGGAAGGDWDMLIGNGRVKAYITANSGVTNVSRRF
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           ------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNN
1khbA1          NPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSV
1qhlA           FDLDELV-TTLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGVCYSMLDTINVRLQQVAGRDRKVDI
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           --LMLLPNILLTGTPGVGKTTLGKELASKSGL--KYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDEL
1e9rA           MPRDAERHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRDKDIILNPYDQRTKGWSF
1jalA1          -----GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDPRLDALAEIVKPERILPTTMEFVD
1mukA           AYLLVKWRMCEAREPSVDLRLLCAGI----DPLNSDPFLKMVSVGP-MLQSTRKYFAQTLFMAKTVSGNA
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           -----TYIVGLTGGIGSGKTTIANLFTDLGV-----PLVDADVVAREVVAPLLSKIVEHFGAQILNRAAL
1udwA           ----------------------------------------------------------------------
1pv4A3          SPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIDERPEEVTEXQRLVKGEVVSTFDEPA
2hydA2          ----------------------------------------------------------------------
2yyeA2          --AQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDKARNLMLSLDATACTDVTAWNICK
1urjA           ----------------------------------------------------------------------
2v3jA1          SKDKITKRXIVVLAXASLETHKIYVLLNCDDH-QGLLKKXGRDISEARPDITH-----QCLLTLLDSPIN
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          EALRDGERVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPENAVEYFISYYDYY
1jbkA           LQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLALDMGALVAGAKYRGEFEERLKGVL
2axpA1          ----------------------------------------------------------------------
1g6oA           DGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEEIVFKHHKNYTQ--LFFGGNITSADCL
1jqjA2          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           FEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVEEPHEVRKLISYLPEEAGAYRNMQG
1kgdA           ----MRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEENGKNYYFVSHDQMMQDISNNEYL
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           VDI-YGLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQTIVGAAPPILSHLLEIRGL--GI
1afrA           ----------------------------------------------------------------------
1g8yA           PNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGPDLLEVGELPTGPVIYLPAEDP---------------
1atrA1          VGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFKHWPFMVV
1tljA           HDKEIGYLDPDILGFLLAFYRNRNDVYTQSSC---SGRITIVDAEMPWDRKNSTIIFKNHLRITEQDLED
1cd5A           PESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFTHDTR
1qhdA1          LQNRRQRTSVLADASETMLANVT-SVRQEYAIPVGPVFPPGMNWT--DLITNYSPSREDNLQRVFTVASI
1iioA           ----------------------------------------------------------------------
1n25A           YNIPKKRYWLFKGPIDSGKTTLAAALLELCGNVNLPLDRLNFELGVAIDQFLVVFEDVKGTGGESRDLPS
1ckvA           QVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIKANGKIEVDCDEISELLGRQFNVYDFLVDVS
1g6hA           ----------------------------------------------------------------------
1s9hA           KKFGKRNTIWLFGPATTGKTNIAEAIAHTVPF--YGCVNWTNENFPFNDCVDKMVIWWEEGKMTAKVVES
1xbtA1          -----GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRLPACLLRDVAQEALGVAVIGIDE
1viaA           --------IVFIGFXGSGKSTLARALAKDLDL----VFLDIEQKFNQKVSEIFEQKRENFFREQEQKXAD
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           LAQFIDKPVCFVGRLEKIHPTG--KMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSY
1l7lA           ANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHP-DQGLICHDAFCGALVMKIGNSGTIP
1d6jA           LRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHA--YRLDGDNIRFGLNKDLGFSEADRNENIRRI
1fl9A           LHTEKAIMVYLNGDLGAGKTTLTRGMLQGI-----GHQGNVKSPTYTLVEEYNIAGKMIYHFDLYRLADP
1pgsA2          TNEKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANTFQHQLGALGCSANPINNQSPGNWTPD
1lw7A2          ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAMQYSDYPQXALGHQRYI
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          ---------------------------------------------------------------ALRPGSF
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           ALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYGGAVGYF---------------TAHGDLDTCVI
1zbsA1          ----------------------------------------------------------------------
1jqjA3          LYVSENQLKITANNPEQEEAEEI-----------LDVTYSGAEMEGFNVSYVLDVLNALKCENVRMMLTD
1e3mA2          NLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEIGPIDRIFTRVGFXVEXTETANILH
1ohcA1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           -------------------------------------------------------------------GSS
3cddA2          GAFDLEXTYKFLGNDAQYKAFIEPIKQGQACTVDIGGERVITGYVDDWVPSYDESTITISVSGRDKTADL
1v47A1          ----------------------------------------------------------------------
1cr0A           LGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAED---------------LI
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           NGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLK---------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          GRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEEVPDERFDWLCEAYKPKSRVPAFLT
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           -----IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHELRKAGAAQTIVASQQRWALMT---
1ovmA2          GYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAA--QQRGELLHHTLGDGEFRHFHM
1mi8A           MKLESAK-VSRVFMTGKKLVYILKTRLGRTIKATANHRFLTIDGWKRLDELSLKEHIALPRKSDISDSIV
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          ------------------------------------------------------------------SEFM
2gtlM1          LDEHDHTVSTTQLRGFYNFGKRELLL-APLKGQSEGYGVICDFNLGDDDHADCKISLFVCAHFNAQ----
1l3aA           ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          LSPNPEVVVA-VGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVP
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          --------VVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKEPYEPSIDVREFVTVEEIMREGYG
1oy5A           ----------------------------------------------------------------------
1gm5A1          -------------------------------------------------------------------GEA
2vnuD1          HKYPLGHFVRDLGTIESAQAETEALLLEHD----------------------------------------
1jmu.1          LIRYPKEAAVALAKRNGGIQWM------------------------------------------------
1odfA           TGNKCPLFIFFSGPQGSGKSFTSIQIYNHLMEKYGG------EKSIGYAS-IDDFYLTHEDQLKLNEQFK
1g8fA3          ----------------------------------------------------------------------
1b77A2          TEIKAEDLQQLL-----RVSRGLQIDTIAITNKDGKIVINGYNKVGLTRPKYSLTLTDYDGSNNFNFVIN
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          IPHFQDKTTVFAGQSGVGKSSLLNAISPTRHVESGGLVADTPGFSSLETDIEEEELGYTFPDIREKSSCK
1oa8A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1l8qA2          NLGSLYNPIFIYGSVGTGKTHLLAAGNEAKKRGYRVIYSSADDFAQAXVEHYKSVDLLLLDDVQFLSGKE
1mkyA1          --------VLIVGRPNVGKST---LFNKL----VKDPVQDTVEWYGKTFKLVDTCGVFDNPQDIISQKXK
1f48A2          IARNEHGLIMLMGKGGVGKTTMAAAIAVRLADMGFDVHLTTSDPAAHL----------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          AVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGY--KVLVLNPSVGSPITYSTYGKFLADGGCSGGAYDIII
4tmkA           -----SKYIVIEGLEGAGKTTARNVVVETLEQLGIRDMVFTREPGGTQLAEKLRSLLLDIKSVGDEVITD
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           --------VLIEGNIGSGKTTYLNHFEKYK----NDICLLTEPVEKWRNVNGVNLLELMYKDPKKW----
1p5zB           -----IKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVARWCNVQSTNGGNVL---------------
1oftA           ----------------------------------------------------------------------
1e69A           LIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPAGSAYVELVFEENGEEITVARELK
1b0uA           LQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLVRDKDGQLKVADKNQLRLLRTRLT
1q3hA           LNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCSQFSWIMPGTIKENIIFGVSYDEY
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          LKIK-GKSLILAQTRE----EAKEKLIPVINKIKDVDLVI--VFLEFLVKRELLKKXIPSQVILNRLKFV
1l7vC           ----------------------------------------------------------------------
1m3eA1          KDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDLLQSKQIKRXISSYVGENAEFERQY
1poiA           ----------------------------------------------------------------------
1ji0A           LKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNKPAHVINXGIALVPEGRRIFPELT
1nijA1          ----PIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVSVDDQLIGDRATQIKTLTNGCICCS
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           EALGKERTKKIYISNGAHEPVFGVATGAMKPI--AKKIKLNQELAEELYATGNYDAMYFAGIIADPKAMS
2iqhA1          LNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELIRMIKRGINRRTRIAYRM
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           -----TRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADGGVSIGPE
1bmfA3          VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIYVAIGQKRSTVAQLVKR-LTDADA
2gk3A1          -------------------------------------------------------LKVLFIGESWHIHIH
1mjgM           ESIRKGDMYVEMGGNRTPAFELVRTV-SESEITDGKIEVIGPDIDQIPEGSKLPLGILVDIYGRKMQADF
1jjvA           ----------------------------------------------------------------------
1udwA           -----PFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNE
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           EAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDFSRVPFNANHRSIGEKFTYPLPFFNR-PL
2v3jA1          ----------------------------------------------------------------------
1ffhA2          PVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDG
2gx8A1          EVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPQQLEVRIETIIPASLQRKVIKAMVTAHPYEEVAYDVYP
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------MRGMLPLFEPKGRVLLVDGHHL--------------AYRTFHALKGLT
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          --------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNEDNVIIDRFVYSNLV
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          -----GNILLLSGHPGSGKSTIAEALANLPGVPKVHFHSDDLWGYIK----HGRIDPWLPQSHQQNRXXQ
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           --------IAIDGPASSGKSTVAKIIAKDFGFDTGAMYRAATYMNQLGVEEVEALLALLDQHPISFGRSE
1e6cA           --------IFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGMTVADVVAAEGWPGFRRRESEATP
1jb1A           ----------------------------------------------------------------------
1afrA           HSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDLNTLDGVRDETGASPTSWAIWTRAW
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           ISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNKEPAELYGIVRTFQTPQPLKEMTV
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           ------------------KRTTXRILIGVQNPELATLVPPLENLDENKLPGLGLFRELVNTCLSQPGLTT
1tmkA           ----RGKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRIGGLINEYLTDDSFQLSDQAIHLLF
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          -----------------------------------------------TVTEIGKHAIDDSEKXIILFGTA
1mm8A           ------------------------------------------RAADWAKSVFSSA-ALGDPRRTA--RLV
1es6A2          ----------------------------------------------------------------------
1vhhA           ----------------------------------------------------------------------
1j1zA2          --------------------------------------------------------------------SM
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          ---------------------------------QDDVYLDITDRLCFAILYSKSASNVHYFSIELEYENF
1f8xA           ----------------------------------------------------------------------
1ii8.1          ---------------------ILARTERERVKKEIKDLEKAKDFTEELIEKVKKYKALAREAALSKIGEL
1f46A           --------------------IIMNVAAHHGSELNGELLLNS-----------IQQAGFIFGDMNIYHRLS
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1cr0A           ----------------------------------------------------------------------
1dhyA1          ----------------------------------------------------------------------
1zs3A1          --------------------------------------------------------AEIDHHKPTAGGHV
1esmA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1f2t.1          RLVGNEWKH-VTEPSSKAISAFMEKLIP-YNIFLNAIYIRQGQIDAILESAREAAL-----SKIGELASE
3cddA1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          -----GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMV
2vgmA3          ----------------------------------------------------------------------
2ancF1          -----GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARS
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           ---------------------------------VGYSIYKGKAALTVEPRS-PEFSPLDSGAFKLSEGMV
1a4iA2          ----------------------------------------------------------------------
1ckeA           ----IAPVITIDGPSGAGKGTLCKAMAEAL----QWHLLDSGAIYRVLALAALHHHVDVASEDALVPLAS
1tueA           KGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHFWLEPLTDTK---VAMLDDATTTCWTY
1w1wA           ----------------------------------------------------------------------
1bccF           --------------------------------------------SRWLEGIRKWYYNAAGNKYGLMRDTI
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           ---PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRLDQGEISAGDAA
2je6I3          IDIMPVKVPRVIGKNKSMYETLTSK--SIFVANNGRIWAFSEEILIEAIRKIE-----------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           ----------------------------------------------------------------------
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          --PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHNNKTELLS------------------
1b77A2          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           --------IFLSGVKRSGKDTTADFIMSNYSAV-KYQLAGPIKDALAVFAANTDYPXLTRKEFEGID--Y
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          KADAGILLNRGQEIFERGSDSLITNLRQGHLEDAIKSLKEGMPVDMASIDLERALNLLDEVTGRSFREDL
1iqrA2          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1bifA1          --------IVMVGLPARGKTYISKKLTRYLNFIGVPTRE-------FNVGQYR-----------------
1p5zB           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           RDNILLGITEDDVPEEAIIEACKAANIYDFIMSLPDGFSTLVGSKGSMLSGGQKQRIAIARALIRDPKIL
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           KAVASLYGVKVN--KNEIMDALESVEVLDLKK------------KLGELSQGTIRRVQLASTLLVNAEIY
1pf4A1          ANNIAYAA-EGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVL
1yvuA2          ----------------------------------------------------------------------
1l7vC           VWHYLTLHQHDKTRTELLNDVAGAL-----------ALDDKLGRSTNQLSGGEWQRVRLAAVVLQAGQLL
1m3eA1          ----------------------------------------------------------------------
1poiA           RKWFEAGKLTEDYSQDVIYMMWHAAALGLPFLPVTLMQGSGLTDEWGISKEVRKTLDKVPDDKFKYIDNP
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           EFIE---------WAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVE
1khbA1          KTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPL----ASGVTITSWKNKEWSSEDGEPCAHPNSRFC
1qhlA           KPFAIQGLPMSVQPTQLVTERQARVLPLNELKDKLEAMEGVQFKQFNSITDYHSLMFDLLRSASDRSKFY
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           DNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATAS
1e9rA           FNEI--------RNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAKKLALIGTPSMRELFHWTTIA
1jalA1          IAGLVAGASKGEGLGNKF------LANIRETDAIGHVVRCFENIDPLDDIDTINTELALADLDSCERAIQ
1mukA           IDSALLRLRTLGADKKALTAQLLMVGLQESEADALAG----------KIMLQDVNTVQLARVVNLAVPDT
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           RE-------------------RVFNHDEDKLWLNNLLHPAIRERMKQKLAEQTAPYTLFVVPLLIENKLT
1udwA           ----------------------------------------------------------------------
1pv4A3          SRHVQVAEXVIEKAKRLVEHKKDVIILLDS-----------------ITRLARAYNTVVPAVLTGGVDAN
2hydA2          ----------------------------------------------------------------------
2yyeA2          NSNIGARIFFEKVPYYQLSENLVKK-----KIYPKGAIENLNFVKNYLKSNLDNWKLILLSDPVTSGGLL
1urjA           ----------------------------------------------------------------------
2v3jA1          KAGKLQVYIQTSRGILIEVNPTVRIPRTFKRFSGLXVQLLHKLSIRSEEKLLKVIKNPITDHLPTKCRKV
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          QPE--------AYVPGKDLYIEKDASINPEIERLRHSTTTRRDVIVVASVSAIYGLGDPREYRARNLVGF
1jbkA           NDLA---KQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRFQKV
2axpA1          ----------------------------------------------------------------------
1g6oA           KSCLRXR------PDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEAFIRLASSNSAARNKFES
1jqjA2          -SEVEFTL--PQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQS---
1zp6A1          ----------------------------------------------------------------------
1vplA           IEY-------LRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLA
1kgdA           EYGSHEDAMYGTKLETIRKIHEQGLIAILDVE--------------PQALKVLRTAEFAPFVVFIAAPTI
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           IDVXNLFGAGAVREDTTISLIVHLENWTPD----QLIFDVPVPKITVPVKVGRNLAIIIEVAAXNFRAKS
1afrA           ----------------------------------------------------------------------
1g8yA           -----PTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWFDGLKRAAEGRRLMVLDTLRR
1atrA1          NDAGRPKVQVEYKGETKSFYPEEVKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLR
1tljA           VLSK---NQVRRLWLIVQGPIIHIYAKNIETGWDILKIAREAGFKHSGILATNQKGVLVELRTGIRMVHL
1cd5A           VANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMWTISCLQLHPKAIM
1qhdA1          RSMLV-----------------------------------------------------------------
1iioA           -SHMKMGV--KEDIRGQIIGALAGADFEELMAALPNGPDTTCKSGDVELKASDAGQVLTADDPFKSAEEV
1n25A           GQGNNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLE
1ckvA           STIGRAYTLGNK-----FTITSELMGLDRKL---------------------------------------
1g6hA           ----------------------------------------------------------------------
1s9hA           AKAILGG---SKVRVDQKCKSSAQIDPTPVIVTS--------NTNMCAVIDGNSTTFEHQQPLQDRMFKF
1xbtA1          GQFFPDI---------------VEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKL----
1viaA           FFSSCEKACIATGGGFVNVSNLEKAGFCIYLKADFEYKDEISKRPLFYDEIKAKKLYNERLSKYEQKANF
1pf4A2          ----------------------------------------------------------------------
1t3wA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1bs2A1          ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1l1oA           VQFKEDSH---PFDLGLYNEAVKIIH------DFPQFYPLGI----------------------------
1l7lA           VNTGLFRWVAPN--NVQGAITLIYNDVPGTYGNNSGSFSVNIG---------------------------
1d6jA           AEVAKLFADSNSIAITSFISPYRKDRDTARQL-------------HEVATPGEETGLPFVEVYVDVPVEA
1fl9A           EELEFMGI-RDYFNTDSICLIEWSEKGQGIEADILVNIDYYDDARNIELIAQTNLGKNIISAF-------
1pgsA2          RAGWCPG--MAVPTRIDVLNNSLTGSTFSYEYKFQS----------------------------------
1lw7A2          DYA----------------VRHSHKIAFIDTD-------FITTQAFCIQYEGKAHPFLDSXIKEYPFDVT
2f9hA1          ----------------------------------------------------------------------
1mm8A           ----------------------------------------------------------------------
1es6A2          HPKLRPILLP-----NKNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVLKLTGGQPIIP
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1i1qA           RSALVENGIATVQAGAGIVLDSVPQ---SEADETRNK------------ARAVLRAIATAH---------
1zbsA1          ---------SEGIACILGTGSNSCLFDGREIKANVSPLGYILGDEGSGAVLGRLFIGSLLKGQXPEG---
1jqjA3          SVSSVQIEDAASQSAAYVVMPMR-----------------------------------------------
1e3mA2          NATE-----YSLVLXDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKALEHGDTIA
1ohcA1          ----------------------------------------------------------------------
1f8xA           -----------------------------------------IYFGAGWFTDRQNKAYKEAMEALKENPTI
1ii8.1          ----------------------------------------------------------------------
1f46A           ----------------------------------------------------------------------
1d8jA           GYKFG--------VLAKIVNYMKTRHQ--RGDTHPLTLDEI-LDETQHLDIGLKQKQWLMEALVNNPKIE
3cddA2          VDCSI--DYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQIEQGETPHELLARLA-KQRGVL
1v47A1          ----------------------------------------------------------------------
1cr0A           GLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYD-----SFAEAETDRLLAKLAYMRLGCDVI
1dhyA1          ----------------------------------------------------------------------
1zs3A1          ----------------------------------------------------------------------
1esmA           -----------ERGLXKKKGFPESYDXHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDIL
1sbxA           ----------------------------------------------------------------------
1dnpA2          ----------------------------------------------------------------------
1ni3A1          VFDIAGLTKGASTGVGLGNAFLSHVRAVDAIYQVVRAFD------DAEIIHVEGDVDPIRDLSIIVDELL
1f2t.1          ----------------------------------------------------------------------
3cddA1          ----------------------------------------------------------------------
1np6A           -------------------ETPDEEELDLQFLASRMDTSKLDLILVEGFKHEEIAKIVLFRDGAGHRPEE
1ovmA2          SEPITVAQAVLTEQNYEIDRVLTTMLRERRPLMLP-----------------------------------
1mi8A           SITETGVEEVFDLTVPGPHNVANDIIVHASI---------------------------------------
1ak2A1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1xl3C1          GDIVALVDXRWAGIHDILANAFSLPTPEIXVRFYQ-DLXRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMA
2gtlM1          ----------------------------------------------------------------------
1l3aA           ----------------------------------------------------------------------
1a4iA2          ------------------------------------------------------------------PAEI
1ckeA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1w1wA           ----------------------------------------------------------------------
1bccF           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
2fggA1          ----------------------------------------------------------------------
1yj5A2          SRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFREXTDP--SHAPVSDXVXFSYRKQFEPPTLAEGFLE
1uouA3          ----------------------------------------------------------------------
1e2hA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1yr6A1          PNGAIYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQMETFLFHEFGVRLMENLPYPLVVYISDPEILKK
1oy5A           ----------------------------------------------------------------------
1gm5A1          LPTLLEEFLNEV--EKMLKNQVNTRRIHQLLKELDDPLL-----ENKDLEEKLQAFLDYVKEIPN-----
2vnuD1          ----------------------------------------------------------------------
1jmu.1          ----------------------------------------------------------------------
1odfA           NNKLL---QGRGLPGTHDMKL-----LQEVLNTIFNQDTVVLPKYDKSQFKGEGDRCPTGQKIKLPVDIF
1g8fA3          ----------------------------------------------------------------------
1b77A2          MANMKIQPGNYKVMGDKVAAKFESSQVSYVIAMEADS---------------------------------
1g31A           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1t9hA2          FRGCLHL----KEPKCAVKQAVEDGELKQYRYDHYVE-----------FMTEIKDR--------------
1oa8A           -------VEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQFAVGEHRAQVSVEVLVEYP-FF
1dekA           ----------------------------------------------------------------------
1l8qA2          RTQIEFFHIFNTLYLLEKQIILASDRHPQKLDGVSDRLSRFEGGILVEIELDNKTRFKIIKEKLKEFNLE
1mkyA1          EVTLNXIREADLVLFVVDGKRGITKEDESLALRKSTVDTILVANK-AENLREFEREVKPELYSLGFGEPI
1f48A2          ----------------------------------------------------------------------
1e6vC           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------
1iqrA2          ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1heiB1          CDEC------------------------------------------------------------------
4tmkA           KAEVLMFYAARVQLVETVIKPALANG--------------------------------------------
1bifA1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1qvrA2          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1pujA           ----------------------------------------------------------------------
1j90A           ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
1e69A           RTGENTYYLNGRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLSGGEKALVGLALLFALPSPFY
1b0uA           MVFQHFNLWSHMTVLENVMSKHDARERALKYLAKVGIDERAQGKYPVHLSGGQQQRVSIARALAMEPDVL
1q3hA           RYKS----------------VVKACQLQQDITKFAEQDNTVLGEGGVTLSGGQRARISLARAVYKDADLY
1sgwA           ----------------------------------------------------------------------
1pf4A1          ----------------------------------------------------------------------
1yvuA2          LLNVAEQV------------LAKTGNIPYKLKEIEGKVDAFVGIDISRITRDGKTVNAVAFTKIFNSKGE
1l7vC           ----------------------------------------------------------------------
1m3eA1          LAGELEVE---LTPQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIKYNKDGSIAIASKPREVREFN
1poiA           ----------------------------------------------------------------------
1ji0A           VYENLXXGAYN------RKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLSGGEQQXLAIGRALXSRPKLL
1nijA1          RSNEL-----EDALLDLLDNLDKGNIQFDRLV-----IECTGMADPGPIIQTFFSHEVLCQRYLLDGVIA
1ex6A           ----------------------------------------------------------------------
1khbA1          ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1t06A           ESDFDRWI--DGAYFYMLSDYVVAV------TLSESNIAQDVADKWIASGDELKMSAGWSWLLGNRKDNA
2iqhA1          CNILKGKFQTAAQRTM-----VDQVRESRNPGNAEFEDLIFLARSALILRGSVAHKSCLPACVYGSAVAS
1rkbA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1mukA           ----------------------------------------------------------------------
1grqA           FRALEGAW-------AEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGV------RCDGA
1bmfA3          MKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYP
2gk3A1          SKGYDSTSSKYEEGATWLLECLRKGGVDIDYXPAHTV----QIAFPESIDELNRYDVIVISDIGSNTFLL
1mjgM           EGVL---------ERRIHDFINYGEGLWHTGQRNINWLRVSKDAVAKGFRFKNYGEILVAKMKEEFPAIV
1jjvA           ----------------------------------------------------------------------
1udwA           LILKT-LKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADT
1pv4A3          ----------------------------------------------------------------------
2hydA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1urjA           NRLLFEAVVGPAAVALRSRNARAAAHLAFDENHEGAALPADITFTAFAGGFEQRLASVMAGDAALASMAV
2v3jA1          ----------------------------------------------------------------------
1ffhA2          ES-----------------------PESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVL
2gx8A1          LDNKGETLGLGKIGYLQEEMTL---------GQFAEHVKQSLDVKGARVVGKLDDKVRKVAVLGGDGNKY
1o7d.2          ------------------FAFCRKLNI-SICPLTQTAERFQV----IVYNPLGRKVDWMVRLPVSKHVYL
1bgxT2          SRGEPVQA--VYGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKAGRAPTPEDFPRQLALIKELD
1c4oA1          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
2axpA1          YAKKFKDYSILTERQRFIEDKIKAKAKVVYLHADPSVIKKRLRVRGYIEGKDIDSILELYREVXSNAGLH
1g6oA           ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1zp6A1          IAADVAGRYAKEGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAEAIERCLDRGG--DSLSDPLVVA
1vplA           ----------------------------------------------------------------------
1kgdA           ----------------------------------------------------------------------
1q3tA           TGDQLVFVGDVDITHNEVTNHVSAIAAIPEVREKLVSLQQEIAQQGGIVMDGR----DIGTVVLPQAELK
1e6cA           NRVVATGGGMVLLEQNRQFMRAHGTVVYLFAPAEELALRLQASLAHQRPTLTGRPIAEEMEAVLREREAL
1jb1A           ----------------------------------------------------------------------
1afrA           TAEENRHGDLLNKYLYLSGRVDMR-QIEKTIQYLIGSGMDPRTENSPYLGFIYTSFQERATFISHGNTAR
1g8yA           ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1tljA           ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1ckvA           ----------------------------------------------------------------------
1g6hA           LENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMI
1s9hA           ----------------------------------------------------------------------
1xbtA1          ----------------------------------------------------------------------
1viaA           ----------------------------------------------------------------------
1pf4A2          ----------------------------------------------------------------------
1t3wA           GQLLEHY--------------RGTNNAATLEKLSXWDDIADKNIAE--QTFTDSLNHXFDSLLELRQEEL
1tmkA           SANRWEIVDKIKKDLLEGKNIVMDRYVYSGVAY----------SAAKGTNGMDLDWCLQPDVGLLKPDLT
1bs2A1          ------------------------------------------------LRSVERNASGITQEKWINADFS
2qgmA1          ------------------------SVQKNIVKSIQSQANPLKT----IEPSKPFEDLKPLKKXIGNAQYV
1l1oA           ----------------------------------------------------------------------
1l7lA           ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
2f9hA1          TDTLKQHAVIQSFPEKDQVTLA-------EGDHLKIGDTNYTITKVGSFANSNLQSIAHSTLIFADAPTD
1mm8A           NVAAQLAKYSGKSITISSEGSKAAQEGAYRFIRNPNV------SAEAIRKAGAMQTVKLAQ----EFPEL
1es6A2          ----------------------------------------------------------------------
1vhhA           ------------LTPLAYKQ--FIPNVAEKTLGASGR------YEGKITRNSERFKELTPNY---NPDII
1j1zA2          DANLLHIGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVEVFFEGDPVAVNGERLSPAALLQ----RLNEI
1i1qA           ----------------------------------------------------------------------
1zbsA1          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1ohcA1          YADF--GPLNLAMVYRYCCKINKKLKSITMLRKKI----------VHFTGSDQRKQANAAFLVGCYMVIY
1f8xA           ----------------------------------------------------------------------
1ii8.1          ASEIFAEFTEGKYSEV--VVRAEENKVRLFVVWEGKERPLTFLSGGERIALGLAFRLAMSLYLAGEISLL
1f46A           PDGSGPALFSLANMVKPGTFDPEMKDFTTPGVT-----IFMQVPSYGDELQLFKLMLQSAQHIADEVGGV
1d8jA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
1v47A1          ------------------------------------------------------PALEIGEDERLDL-EN
1cr0A           ----------------------------------------------------------------------
1dhyA1          --------------GYLGFAVKDVPAWDHFLTKSVG-----------LMAAGSAGDAALYRADQRAWRIA
1zs3A1          LSNLFIENIRLT-QAGIYAKSPVKCEYLREIAQREVEYFFKISD----LLLDENEIVPSTTEEFLKYHKF
1esmA           ----------------------------------------------------------------------
1sbxA           ------------------------------------------------RSTERCETVTISCFVVGGEKRL
1dnpA2          -------------QDLRLHDNLALAAACRNSSARVLALYIATPRQWATHNMSPRQAELINAQLNGLQIAL
1ni3A1          ----------------------------------------------------------------------
1f2t.1          IFAEFTEGKYSEVVVRAEENKVRLFVVWEG-KERPLTFL----SGGERIALGLAFRLAMSLYLAGEISLL
3cddA1          -----------------------------------RGRFSWRQRFSKFTIKAAKADVTDSEIGRYRPLII
1np6A           ----------------------------------------------------------------------
1ovmA2          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
1ak2A1          LELI--EKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHSD
2vgmA3          ---------------------------------VMDEFLLHLNKDDDKAWYGE-KEVVKAAEYGAISYLL
2ancF1          IFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQ
1xl3C1          ----------------------------------------------------------------------
2gtlM1          ----------------------------------------------------------------------
1l3aA           MLQFAPAAGVRQYDWSRKQVFSLSVTEIGSIISLGTKD---SCEFFHDPNKGRSDEGRVRKVLKVEPL--
1a4iA2          ----------------------------------------------------------------------
1ckeA           HLDVRFVVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADG-----RDMGTVVFPDAPVK
1tueA           FDTYMRNALD------------------------------------------------------------
1w1wA           ----------------------------------------------EYLSGGEKTVAALALLFYQPSPFF
1bccF           YENDDVKEAIRRLPENLYDDRMFRIKRALDLNMRQQI----------LPKEQWTKYEEDVPYLEPYLKEV
2pa7A1          ------------------------------------------------VLVCLNGSCRVILDDGNIIQEI
2fggA1          ------------------------------------EEHDERTRAKARLSWAGRQXVGVGLARLDPA---
1yj5A2          ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
1e2hA           VVMTSAQI--TMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAALLCYPAARYLMGSMTPQAVLA
2je6I3          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1oy5A           --------------KERIMIICGRYEGVD--ERVKKIVDMEISLGDFILSGGEIVALAVIDAVSRVLPGV
1gm5A1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g8fA3          ----------------------------------------------------------------------
1b77A2          ----------------------------------------------------------------------
1g31A           -----------------------------------------------------------LPIRAVGEYVI
1em8A           -----------------------------------------------------------------NATFY
1t9hA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1dekA           DRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAFNKITDVINNIEDQWSV-----
1l8qA2          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1e6vC           -------------------------------------------AENRRKYMNPNYELKKLREIPDEDIVR
1xzpA1          LDTI------------------------------------------------------------------
1iqrA2          ------------------------------------PVVGLVVLDPNNLKTTPRRRAWFLENVRA-----
4tmkA           ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1p5zB           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:1330
query           LLDEATSALDSESEKVVQVALDAAAKGRTTIAVAHRLSTIQKADVIYVFDQGRITESGTHSELLAKKGRY
1e69A           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
1sgwA           VLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSR-EELSYCDVNENLHKY------------------
1pf4A1          ILDEATSALDTESERAIQAALDELQKNKTVLVIAHRLSTIEQADEILVVDEGEIIERGRHAD--------
1yvuA2          ----------------------------------------------------------------------
1l7vC           LLDEPXNSLDVAQQSALDKILSACQQGLAIVXSSHDLNTLRHAHRAWLLKGGKXLASGRREEVLT-----
1m3eA1          ----------------------------------------------------------------------
1poiA           FKPQASPDGTVRIWGGKFQDVDIAEAAKYTIVTCEEI---------------------------------
1ji0A           ----------------------------------------------------------------------
1nijA1          ----------------------------------------------------------------------
1ex6A           DLKKRLEGRGTETEESINKRLSAAQAEHDKVIVNDDLDKAYKLKDFIFAEK-------------------
1khbA1          TPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEAKIIMHDPFAMRPF
1qhlA           RLIEASGGISSAITRSLRDYL-------------------------------------------------
1t06A           ----------------------------------------------------------------------
2iqhA1          ----------------------------------------------------------------------
1rkbA           YKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDH-----------------------------------
1e9rA           TFDDLRGFLEGTLAESLFAGSNEASKTSARFVLSDKLPHVTMPDGDFSIRSWLEDPNGGN----------
1jalA1          RLQKRAKGGDKEAKFELSVMEKILPVLENAGMIGLDKEELQAIKSYNFLTLKPTMYIANVNEDGFENNPY
1mukA           WMSLDFDSMFKHHVKLLPKDGHLNTDIPPRMGWL--------RAILRFLGAGMVMTATGVAVDIY-----
1grqA           ----------------------------------------------------------------------
1bmfA3          ----------------------------------------------------------------------
2gk3A1          ----------------------------------------------------------------------
1mjgM           ----------------------------------------------------------------------
1jjvA           ALCDRILVVDVSPQTQLARSANFEQIQRIMNSQVSQQERLKWADDVINNDAELAQNLPHLQQKVLEHQFY
1udwA           ----------------------------------------------------------------------
1pv4A3          ALHRPKRFFGAARNVEEGGSL----TIIATALIDTGSKXDEVYEEFKGTGNXELHLSRK----IAEKRVF
2hydA2          ----------------------------------------------------------------------
2yyeA2          FTINKEKLEK-----IDETAKELEVNYWIIGETIAE----------------------------------
1urjA           ----------------------------------------------------------------------
2v3jA1          TLSFDAPVIRVQDYIEKLDDDESICVFVGAXARGKDNFADEYVDEKVGLSNYPLSASVACSKFC------
1ffhA2          ----------------------------------------------------------------------
2gx8A1          ----------------------------------------------------------------------
1o7d.2          ----------------------------------------------------------------------
1bgxT2          ----------------------------------------------------------------------
1c4oA1          VLFPATHYLSPEGLEEILKEIEKELWERVRY---------------------------------------
1jbkA           FVAEPSVEDTIA----------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1g6oA           LIEGFKDLID-----------------XIVHINHHKQCDE------------------------------
1jqjA2          -LPSHSVIVPRKGVIELMRMLD-GGDNPLRVQIGSNNIRAHVGDFIFT----------------------
1zp6A1          ----------------------------------------------------------------------
1vplA           ILDEPTSGLDVLNREVRKILKQASQEGLTLVSSHNMLEVEFLCDRIALIHNGTIVETGTVEELKERYKAQ
1kgdA           TPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRLEEA------------------------
1q3tA           ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1jb1A           XGYDATKTFEKNLNHLIE----------------------------------------------------
1afrA           ----------------------------------------------------------------------
1g8yA           FHIEEENASGPMAQVIGRMEAIAADTGCSIVFLHHLVDNIRWQSYLSSMTSAEAEEWGVDDDQRRFFVRF
1atrA1          IINEPTAAAIAYGL--------------------------------------------------------
1tljA           LRESNTERVDKDKKTLVNVCNEVLARGKQKMNLLKD----------------------------------
1cd5A           VCDEPSTMELKVKTLRYFNELEAENI--------------------------------------------
1qhdA1          ----------------------------------------------------------------------
1iioA           ADTIVNKA--------------------------------------------------------------
1n25A           RSEFLLEKRIIQSGIALLLMLIWYRPEFAQSIQSRIVEWKERDKEFSLSVYQKMK