[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for cimm2:CIRT_10408

[Show Plain Result]

#ERROR : Can't open dsspfile "2h6bA2.bssp"
#ERROR : Can't open dsspfile "1cx4A2.bssp"
#ERROR : Can't open dsspfile "1o7fA3.bssp"
#ERROR : Can't open dsspfile "1cgpA2.bssp"
#ERROR : Can't open dsspfile "1wgpA.bssp"
#ERROR : Can't open dsspfile "1cx4A1.bssp"
#ERROR : Can't open dsspfile "1omiA1.bssp"
#ERROR : Can't open dsspfile "1o5lA1.bssp"
#ERROR : Can't open dsspfile "2cohA2.bssp"
#ERROR : Can't open dsspfile "1o7fA2.bssp"
#ERROR : Can't open dsspfile "2gauA2.bssp"
#ERROR : Can't open dsspfile "1u12A.bssp"
#ERROR : Can't open dsspfile "1q3eA.bssp"
#ERROR : Can't open dsspfile "1ft9A2.bssp"
#ERROR : Can't open dsspfile "1omiA2.bssp"
#ERROR : Can't open dsspfile "1zybA2.bssp"
#ERROR : Can't open dsspfile "2gauA1.bssp"
#ERROR : Can't open dsspfile "2h6bA1.bssp"
#ERROR : Can't open dsspfile "1ft9A1.bssp"
#ERROR : Can't open dsspfile "1cgpA1.bssp"
#ERROR : Can't open dsspfile "2cohA1.bssp"
#ERROR : Can't open dsspfile "1e2xA1.bssp"
#ERROR : Can't open dsspfile "1zybA1.bssp"
#ERROR : Can't open dsspfile "1c9bA2.bssp"
#ERROR : Can't open dsspfile "1sfuA.bssp"
#ERROR : Can't open dsspfile "1q1hA.bssp"
#ERROR : Can't open dsspfile "3bwgA1.bssp"
#ERROR : Can't open dsspfile "1xcbA1.bssp"
#ERROR : Can't open dsspfile "1qbjA.bssp"
#ERROR : Can't open dsspfile "1h3dA2.bssp"
#ERROR : Can't open dsspfile "1v4rA1.bssp"
#ERROR : Can't open dsspfile "2hs5A1.bssp"
#ERROR : Can't open dsspfile "1lvaA3.bssp"
#ERROR : Can't open dsspfile "2g9wA1.bssp"

## Summary of PDB Search
:221
    6e-21  16%  2h6bA2 [b.82.3.2] CHLOROPHENOL REDUCTION GENE K A:3 -- 147
    8e-21  20%  1cx4A2 [b.82.3.2] CAMP-DEPENDENT PROTEIN KINASE REGULATORY SUBUNIT
    1e-19  23%  1o7fA3 [b.82.3.2] CAMP-DEPENDENT RAP1 GUANINE-NUCLEOTIDE EXCHANGE
    3e-19  24%  1cgpA2 [b.82.3.2] PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN (CAP)
    3e-19  19%  1wgpA  [b.82.3.2] PROBABLE CYCLIC NUCLEOTIDE-GATED ION CHANNEL 6
    5e-19  30%  1cx4A1 [b.82.3.2] CAMP-DEPENDENT PROTEIN KINASE REGULATORY SUBUNIT
    1e-18  14%  1omiA1 [b.82.3.3] LISTERIOLYSIN REGULATORY PROTEIN A:1005 -- 1137
    1e-18  23%  1o5lA1 [b.82.3.2] TRANSCRIPTIONAL REGULATOR, CRP FAMILY A:1 -- 129
    1e-17  33%  2cohA2 [b.82.3.2] TRANSCRIPTIONAL REGULATOR A:6 -- 117
    2e-17  24%  1o7fA2 [b.82.3.2] CAMP-DEPENDENT RAP1 GUANINE-NUCLEOTIDE EXCHANGE
    4e-16  23%  2gauA2 [b.82.3.2] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY A:10 --
    5e-16  30%  1u12A  [b.82.3.2] CYCLIC NUCLEOTIDE BINDING DOMAIN
    1e-15  30%  1q3eA  [b.82.3.2] POTASSIUM/SODIUM HYPERPOLARIZATION-ACTIVATED
    1e-15  15%  1ft9A2 [b.82.3.1] CARBON MONOXIDE OXIDATION SYSTEM TRANSCRIPTION
    7e-14  17%  1omiA2 [a.4.5.4] LISTERIOLYSIN REGULATORY PROTEIN A:1138 -- 1237
    1e-11  19%  1zybA2 [b.82.3.2] TRANSCRIPTION REGULATOR, CRP FAMILY A:1 -- 147
    3e-10  33%  2gauA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY A:152 --
    1e-09  15%  2h6bA1 [a.4.5.4] CHLOROPHENOL REDUCTION GENE K A:148 -- 229
    4e-07  32%  1ft9A1 [a.4.5.4] CARBON MONOXIDE OXIDATION SYSTEM TRANSCRIPTION
    2e-06  31%  1cgpA1 [a.4.5.4] PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN (CAP)
    2e-05  32%  2cohA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR A:118 -- 199
    3e-05  31%  1e2xA1 [a.4.5.6] FATTY ACID METABOLISM REGULATOR PROTEIN A:6 -- 78
    4e-05  16%  1zybA1 [a.4.5.4] TRANSCRIPTION REGULATOR, CRP FAMILY A:148 -- 220
    1e-04  12%  1c9bA2 [a.74.1.2] GENERAL TRANSCRIPTION FACTOR IIB A:208 -- 316
    1e-04  15%  1sfuA  [a.4.5.19] 34L PROTEIN
    1e-04  22%  1q1hA  [a.4.5.41] TRANSCRIPTION FACTOR E
    5e-04  23%  3bwgA1 [a.4.5.6] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL A:5 -- 82
    6e-04  16%  1xcbA1 [a.4.5.38] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX A:4
    7e-04  25%  1qbjA  [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
    7e-04  22%  1h3dA2 [d.58.5.3] ATP-PHOSPHORIBOSYLTRANSFERASE A:225 -- 299
    7e-04  22%  1v4rA1 [a.4.5.6] TRANSCRIPTIONAL REPRESSOR A:1 -- 100
    8e-04  19%  2hs5A1 [a.4.5.6] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:25 -- 93
    8e-04  14%  1lvaA3 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:511
    0.001  13%  2g9wA1 [a.4.5.39] CONSERVED HYPOTHETICAL PROTEIN A:3 -- 124
:221

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNDAPLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMG
2h6bA2          -----IPDNFFPIEKLRNYTQMGLIRDFAKGSAVIMPGEEITSMIFLVEGKIKLDIIFEDGSEKLLYYAG
1cx4A2          -----PFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVRI--TMKRNGAVEIARCL
1o7fA3          -----KALSHLSTTVKRELAGVLIFESAKGGTVLFNQGEEGTSWYIILKGSVNV----VIYGKGVVCTLH
1cgpA2          -----------------WFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLN
1wgpA           -----PLFENMDERLLDAICERLKPCLFTEKSYLVREGDPVNEMLFIIRGRLESVTTDGGRGFYNRSLLK
1cx4A1          -----LLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKC-DGVGRCVGNYD
1omiA1          -------------------TNGIKPKQFHKKELIFNQWDPQEYCIFLYDGITKLTSISENGTIMNLQYYK
1o5lA1          -----------------KLLPCGKVIVFRKGEIVKHQDDPIEDVLILLEGTLKTEHVSENGKTLEIDEIK
2cohA2          --------------------------SFKAGDVILYPGVPGDRAYRVLEGLVRLEAVDEEGNALTLRLVR
1o7fA2          -----KAFEKFHPNLLRQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSDAVTICTLG
2gauA2          -----DVWSLLNEEERELLDKEIQPFPCKKASTVFSEGDIPNNLFYLYEGKIKILR-----RFHISRIVK
1u12A           -----PLFQKLGPAVLVEIVRALRARTVPAGAVICRIGEPGDRMFFVVEGSVSVATPNPVEL-------G
1q3eA           -----PLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTGNKEMKL------S
1ft9A2          -----NIANVLLSPDGETFFRGFRSKIHAKGSLVCTGEGDENGVFVVVDGRLRV-YLVGEEREISLFYLT
1omiA2          ----------------------------------------------------------------------
1zybA2          --LQLPLFQGLCHEDFTSIKVKLHFIKHKAGETIIKSGNPCTQLCFLLKGEISIVTNAKENIYTVIEQIE
2gauA1          ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1ft9A1          ----------------------------------------------------------------------
1cgpA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1e2xA1          ----------------------------------------------------------------------
1zybA1          ----------------------------------------------------------------------
1c9bA2          ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
3bwgA1          ----------------------------------------------------------------------
1xcbA1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1h3dA2          ----------------------------------------------------------------------
1v4rA1          ----------------------------------------------------------------------
2hs5A1          ----------------------------------------------------------------------
1lvaA3          ----------------------------------------------------------------------
2g9wA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVXXXXXXXXXXXXXXXNDVVADLVF
2h6bA2          GNSLIGKLYPT---GNNIYATAMEPTRTCWFSEKSLRTVFRTDEDMIFEIFKNYLTKVAYYARQVAEMNT
1cx4A2          RGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIV-
1o7fA3          EGDDFGKLALVNDAPRASIVLREDNCHFLRVDKEDFNRILRDVE--------------------------
1cgpA2          QGDFIGELGLFEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAF
1wgpA           EGDFCGDELLTWALDSTRTVKALTEVEAFALIADELKFVASQFR--------------------------
1cx4A1          NRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNN--------------------------
1omiA1          GAFVIMSGFIDTETSVGYYNLEVISATAYVIKINELKELLSKNL--------------------------
1o5lA1          PVQIIASGFIFSSEPRPVNVVAGENSKILSIPKEVFL---------------------------------
2cohA2          PGGFFGEEALFG-QERIYFAEAATDV--------------------------------------------
1o7fA2          IGTAFGE-SILDNTPRHATIVTRESSELLRIEQEDFKALWEKYR--------------------------
2gauA2          PGQFFGMRPYFAEETCSSTAIAVENSKVLAIPVEAIEALLKGNTSFCRYFLKALAKELGYAERRTVTLTQ
1u12A           PGAFFGEMALISGEPRSATVSAATTVSLLSLHSADFQMLCSSSP--------------------------
1q3eA           DGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYP--------------------------
1ft9A2          SGDMF-------CMHSGCLVEATERTEVRFADIRTFEQKLQTCPSMAWGLIAILGRALTSCMRTIEDLMF
1omiA2          ----------------------------------------------------------------------
1zybA2          APYLIEPQSLFGXNTNASSYVAHTEVHTVCISKAFVLSDL------------------------------
2gauA1          ----------------------------------------------------------------------
2h6bA1          ----------------------------------------------------------------------
1ft9A1          ----------------------------------------------------------------------
1cgpA1          ----------------------------------------------------------------------
2cohA1          ----------------------------------------------------------------------
1e2xA1          ----------------------------------------------------------------------
1zybA1          ----------------------------------------------------------------------
1c9bA2          ----------------------------------------------------------------------
1sfuA           ----------------------------------------------------------------------
1q1hA           ----------------------------------------------------------------------
3bwgA1          ----------------------------------------------------------------------
1xcbA1          ----------------------------------------------------------------------
1qbjA           ----------------------------------------------------------------------
1h3dA2          ----------------------------------------------------------------------
1v4rA1          ----------------------------------------------------------------------
2hs5A1          ----------------------------------------------------------------------
1lvaA3          ----------------------------------------------------------------------
2g9wA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNKALADFASRGWLRLEPRSVVI
2h6bA2          ----------------------------------------------------------------------
1cx4A2          ----------------------------------------------------------------------
1o7fA3          ----------------------------------------------------------------------
1cgpA2          ----------------------------------------------------------------------
1wgpA           ----------------------------------------------------------------------
1cx4A1          ----------------------------------------------------------------------
1omiA1          ----------------------------------------------------------------------
1o5lA1          ----------------------------------------------------------------------
2cohA2          ----------------------------------------------------------------------
1o7fA2          ----------------------------------------------------------------------
2gauA2          ----------------------------------------------------------------------
1u12A           ----------------------------------------------------------------------
1q3eA           ----------------------------------------------------------------------
1ft9A2          ----------------------------------------------------------------------
1omiA2          ----GSICGQLLILTYVYGKETPDG-------IKITLDNLTMQELSAVSRIISKLKQEKVIVYKNSCFYV
1zybA2          ----------------------------------------------------------------------
2gauA1          --VRGRLAETLLILKENF-GFENDGATLSIYLSREELATLSNMTVSNAIRTLSTFVSERMLALDGKRIKI
2h6bA1          -NPTIRILRLFYELCSSQGKRVGDTYEITMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNKIIV
1ft9A1          -DIKQRIAGFFIDHANT--TGRQTGVIVSVDFTVEEIANLIGSSRQTTSTALNSLIKEGYISRQGRGYTI
1cgpA1          -DVTGRIAQTLLNLAKQP-DAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVV
2cohA1          --LKNRXAAALLELSETPLAHEEE-GKVVLKATHDELAAAVGSVRETVTKVIGELAREGYIRSGYGKIQL
1e2xA1          --------------------------------AERELSELIGVTRTTLREVLQRLARDGWLTIQHGK---
1zybA1          -------------IIRFFLSHCEKPQGEKTFVKXDDLARCLDDTRLNISKTLNELQDNGLIELHRKEILI
1c9bA2          -----------------------------EKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFD
1sfuA           -------------------------------TTAISLSNRLKINKKKINQQLYKLQKEDTVKMVP-----
1q1hA           -------------------------------MTDEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTR---
3bwgA1          --------------------------------VLETLXAQFEVSKSTITKSLELLEQKGAIFQVRGS---
1xcbA1          -------------SRLITYLRILEELEAQGVTSSEQLGELAQVTAFQVRKDLSYFGSYGTRGV--GYTVP
1qbjA           -------------------------------TTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGT---
1h3dA2          -------------------------------PTILPLAMHMVSSETLFWETMEKLKALGAS-----SILV
1v4rA1          -------------VATHFRTLIKSGELAPGDPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGAL---
2hs5A1          -------------------------------LSEPDICAALDVSRNTVREAFQILIEDRLVAHELNR---
1lvaA3          -------------------------------PSFKEVAGSFNLDPSELEELLHYLVREGVLVKINDE---
2g9wA1          ---------------------WSRTEPQTVRQVHEALSARRDLAYTTVXAVLQRLAKKNLVLQIRAHRYA


                         .         .         .         +         .         .         .:280
query           MDIERMARRAR
2h6bA2          -----------
1cx4A2          -----------
1o7fA3          -----------
1cgpA2          -----------
1wgpA           -----------
1cx4A1          -----------
1omiA1          -----------
1o5lA1          -----------
2cohA2          -----------
1o7fA2          -----------
2gauA2          -----------
1u12A           -----------
1q3eA           -----------
1ft9A2          -----------
1omiA2          QNLDYLKRYAP
1zybA2          -----------
2gauA1          IDCDRLQKTAR
2h6bA1          GELKHLSEQT-
1ft9A1          PNLVRLKAAA-
1cgpA1          -----------
2cohA1          LD---------
1e2xA1          -----------
1zybA1          PDAQKL-----
1c9bA2          TPVDKLPQ---
1sfuA           -----------
1q1hA           -----------
3bwgA1          -----------
1xcbA1          VLKRELRH---
1qbjA           -----------
1h3dA2          LPIEKM-----
1v4rA1          -----------
2hs5A1          -----------
1lvaA3          -----------
2g9wA1          PVHGRDELVAG