[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:etfB.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1efpB.bssp"
#ERROR : Can't open dsspfile "1t9gS.bssp"
#ERROR : Can't open dsspfile "1efvB.bssp"
#ERROR : Can't open dsspfile "2a1uB.bssp"
#ERROR : Can't open dsspfile "2a1tS.bssp"
#ERROR : Can't open dsspfile "1o96A.bssp"
#ERROR : Can't open dsspfile "1o94E.bssp"
#ERROR : Can't open dsspfile "1o94C.bssp"
#ERROR : Can't open dsspfile "1o96C.bssp"
#ERROR : Can't open dsspfile "3cltC.bssp"
#ERROR : Can't open dsspfile "3clrC.bssp"
#ERROR : Can't open dsspfile "3cluC.bssp"
#ERROR : Can't open dsspfile "1o97C.bssp"
#ERROR : Can't open dsspfile "1o96Q.bssp"

## Summary of PDB Search
:262
    3e-14  25%  1efpB  [c.26.2] PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
    4e-13  29%  1t9gS  [c.26.2] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    4e-13  29%  1efvB  [c.26.2] ELECTRON TRANSFER FLAVOPROTEIN
    1e-12  29%  2a1uB  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    1e-12  29%  2a1tS  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    1e-10  26%  1o96A  [c.26.2] ELECTRON TRANSFERRING FLAVOPROTEIN BETA-SUBUNIT
    1e-10  26%  1o94E  [c.26.2] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    1e-10  27%  1o94C  [c.26.2] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    2e-10  27%  1o96C  [c.26.2] ELECTRON TRANSFERRING FLAVOPROTEIN BETA-SUBUNIT
    3e-10  27%  3cltC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    3e-10  27%  3clrC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    4e-09  27%  3cluC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    7e-09  27%  1o97C  [c.26.2] ELECTRON TRANSFERRING FLAVOPROTEIN BETA-SUBUNIT
    6e-08  27%  1o96Q  [c.26.2] ELECTRON TRANSFERRING FLAVOPROTEIN BETA-SUBUNIT
:262

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIMVCIKQVPGTSKVEVDEKTGVLKRDGVDSKMNPYDLYALETALRIKEKKGGNIKVISMGPPQAKAVI
1efpB           MKVLVPVKRIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKQAEEIIAVSIGVKQAAETL
1t9gS           LRVLVAVKRVIDYAKIRVKDRTGVVT-DGVKHSMNPFEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQETI
1efvB           LRVLVAVKRVIDYAKIRVKDRTGVVT-DGVKHSMNPFEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQETI
2a1uB           LRVLVAVKRVIDYAKIRVKDRTGVVT-DGVKHSMNPFEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQETI
2a1tS           LRVLVAVKRVIDYAKIRVKDRTGVVT-DGVKHSMNPFEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQETI
1o96A           MKILVAVKQ---TAALEEDFEI----RDGMDVDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXXL
1o94E           MKILVAVKQ---TAALEEDFE---IREDGMDVDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXXL
1o94C           MKILVAVKQ---TAALEEDFEI----RDGMDVDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXXL
1o96C           MKILVAVKQ---TAALEEDFEI----RDGMDVDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXXL
3cltC           MKILVAVKQ---TAALEEDFE---IREDGMDVDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXXL
3clrC           MKILVAVKQ---TAALEEDFE---IREDGMDVDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXXL
3cluC           MKILVAVKQ---TAALEEDFE---IREDGMDVDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXXL
1o97C           MKILVAVKQ---TAALEEDFE---IREDGMDVDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXXL
1o96Q           MKILVAVKQ---TAALEEDFEI----RDGMDVDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXXL


                         .         .         *         .         .         .         .:140
query           KEAYSMGADEGTLVSDRKFAGADVLATSYTLSQGVKKCGDFDIILCGKQTTDGDTAQVGPEMAEYLGIPH
1efpB           RTALAMGADRAILVVAADDVQQDIEPXXXXXXXXXXXXXETELIIAGKQAIDNDMNATGQMLAAILGWAQ
1t9gS           RTALAMGADRGIHVEPAEAERLGPLQVARVLAKLAEK-EKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ
1efvB           RTALAMGADRGIHVEPAEAERLGPLQVARVLAKLAEK-EKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ
2a1uB           RTALAMGADRGVEVPPAEAERLGPLQVARVLAKLAEK-EKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ
2a1tS           RTALAMGADRGVEVPPAEAERLGPLQVARVLAKLAEK-EKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ
1o96A           RKCLAKGXXXXXXXXXXXXEGSDAIVVGRILTEVIKKEAP-DMVFAGVQSSDQAYASTGISVASYLNWPH
1o94E           RKCLAKGXXXXXXXXXXXXEGSDAIVVGRILTEVIKKEAP-DMVFAGVQSSDQAYASTGISVASYLNWPH
1o94C           RKCLAKGXXXXXXXXXXXXEGSDAIVVGRILTEVIKKEAP-DMVFAGVQSSDQAYASTGISVASYLNWPH
1o96C           RKCLAKGXXXXXXXXXXXXEGSDAIVVGRILTEVIKKEAP-DMVFAGVQSSDQAYASTGISVASYLNWPH
3cltC           RKCLAKGXXXXXXXXXXXXEGSDAIVVGRILTEVIKKEAP-DMVFAGVQSSDQAYASTGISVASYLNWPH
3clrC           RKCLAKGXXXXXXXXXXXXEGSDAIVVGRILTEVIKKEAP-DMVFAGVQSSDQAYASTGISVASYLNWPH
3cluC           RKCLAKGXXXXXXXXXXXXEGSDAIVVGRILTEVIKKEAP-DMVFAGVQSSDQAYASTGISVASYLNWPH
1o97C           RKCLAKGXXXXXXXXXXXXEGSDAIVVGRILTEVIKKEAP-DMVFAGVQSSDQAYASTGISVASYLNWPH
1o96Q           RKCLAKGXXXXXXXXXXXXEGSDAIVVGRILTEVIKKEAP-DMVFAGVQSSDQAYASTGISVASYLNWPH


                         +         .         .         .         .         *         .:210
query           VANVRRILDVNDDFIKVEMDMPNTIEVLEVKYPCLLTVDKDIFQPRLPSYKKKLETDEREINVISLNDFE
1efpB           ATFASKV-EIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPL--------D
1t9gS           GTFASQVT-LEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPR------------------------
1efvB           GTFASQVT-LEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPR------------------------
2a1uB           GTFASQV-TLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPR------------------------
2a1tS           GTFASQV-TLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPR------------------------
1o96A           VADLQYKPGDNKAVIRRELE-GGMLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADI-
1o94E           VADLQYKPGDNKAVIRRELE-GGMLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADI-
1o94C           VADLQYKPGDNKAVIRRELE-GGMLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADI-
1o96C           VADLQYKPGDNKAVIRRELE-GGMLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADI-
3cltC           VADLQYKPGDNKAVIRRELE-GGMLQEVEINCPAVLTIQLGINKPRYASTKPIEEVSLADIG-LSAND--
3clrC           VADLQYKPGDNKAVIRRELE-GGMLQEVEINCPAVLTIQLGINKPRYASTKPIEEVSLADIG-LSAND--
3cluC           VADLQYKPGDNKAVIRRELE-GGMLQEVEINCPAVLTIQLGINKPRYAS---------KPIEEVSLADI-
1o97C           VADLQYKPGDNKAVIRRELE-GGMLQEVEINCPAVLTIQLGINKPRYAS---------------------
1o96Q           VADLQYKPGDNKAVIRRELE-GGMLQEVEINCPAVLTIQLGINKP-------------------------


                         .         .         .         +         .         .         .:280
query           DKDEKKYGLNGSPTQVERIFPPSNNDDHEIWTGDSSELSERMEDKLRELKxx
1efpB           EKTAADYGVDVAP---------------------------------------
1t9gS           ----------------------------------------------------
1efvB           ----------------------------------------------------
2a1uB           ----------------------------------------------------
2a1tS           ----------------------------------------------------
1o96A           GLSANDVGAAQSMSRVRRMYIPEKGRATMI-EGTISEQAAKIIQIINEFK--
1o94E           GLSANDVGAAQSMSRVRRMYIP------------------------------
1o94C           GLSANDVGAAQSMSRVRRMYIP------------------------------
1o96C           GLSANDVGAAQSMSRVRRMYIP------------------------------
3cltC           ------VGAAQSMSRVRRMYIPEKGRATMI-EGTISEQAAKIIQIINEFK--
3clrC           ------VGAAQSMSRVRRMYIPEKGRATMI-EGTISEQAAKIIQIINEFK--
3cluC           GLSANDVGAAQSMSRVRRMYIP------------------------------
1o97C           ----------------------------------------------------
1o96Q           ----------------------------------------------------