[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE0434

[Show Plain Result]

#ERROR : Can't open dsspfile "1i21B.bssp"
#ERROR : Can't open dsspfile "1i21Y.bssp"
#ERROR : Can't open dsspfile "1i21N.bssp"
#ERROR : Can't open dsspfile "1i21M.bssp"
#ERROR : Can't open dsspfile "1i21A.bssp"
#ERROR : Can't open dsspfile "1i1dD.bssp"
#ERROR : Can't open dsspfile "1i1dC.bssp"
#ERROR : Can't open dsspfile "1i1dA.bssp"
#ERROR : Can't open dsspfile "1i12D.bssp"
#ERROR : Can't open dsspfile "1i12C.bssp"
#ERROR : Can't open dsspfile "1i12B.bssp"
#ERROR : Can't open dsspfile "1i12A.bssp"
#ERROR : Can't open dsspfile "2cnmA.bssp"
#ERROR : Can't open dsspfile "3i3gA.bssp"
#ERROR : Can't open dsspfile "3fb3B.bssp"
#ERROR : Can't open dsspfile "3fb3A.bssp"

## Summary of PDB Search
:162
    5e-05  32%  1i21B  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-05  36%  1i21Y  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-05  36%  1i21N  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-05  36%  1i21M  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-05  36%  1i21A  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-05  36%  1i1dD  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-05  36%  1i1dC  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-05  36%  1i1dA  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-05  36%  1i12D  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-05  36%  1i12C  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-05  36%  1i12B  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    9e-05  36%  1i12A  [d.108.1] GLUCOSAMINE-PHOSPHATE N-ACETYLTRANSFERASE
    1e-04  32%  2cnmA  [x.x.x] MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN
    6e-04  31%  3i3gA  [x.x.x] N-ACETYLTRANSFERASE
    6e-04  31%  3fb3B  [x.x.x] N-ACETYLTRANSFERASE
    6e-04  31%  3fb3A  [x.x.x] N-ACETYLTRANSFERASE
:162

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxENSLK
1i21B           -----------------------------------------------------------------DNDKK
1i21Y           ----------------------------------------------------------------------
1i21N           ----------------------------------------------------------------------
1i21M           ----------------------------------------------------------------------
1i21A           ----------------------------------------------------------------------
1i1dD           ----------------------------------------------------------------------
1i1dC           ----------------------------------------------------------------------
1i1dA           ----------------------------------------------------------------------
1i12D           ----------------------------------------------------------------------
1i12C           ----------------------------------------------------------------------
1i12B           ----------------------------------------------------------------------
1i12A           ----------------------------------------------------------------------
2cnmA           -----------------------------------------------------------------EKTFF
3i3gA           ----------------------------------------------------------------------
3fb3B           ----------------------------------------------------------------------
3fb3A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GNFKNRCVFLENENGERIGTIMIVPSLSEEEGVQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVEGATR
1i21B           IQYNPVIVDKRTETVAATGNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
1i21Y           ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
1i21N           ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
1i21M           ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
1i21A           ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
1i1dD           ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
1i1dC           ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
1i1dA           ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
1i12D           ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
1i12C           ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
1i12B           ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
1i12A           ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
2cnmA           GNQGERYLNLKLTADDRMAAFAITQVVLDEATLFNI---AVDPDFQRRGLGRMLLEH---LIDELEGVVT
3i3gA           -------VFCHQPTGRIVGSLMIQPKFTRGRAVGHIEDVVVDPSYRGAGLGKALIMDLCE-ISRSKGCYK
3fb3B           -------VFCHQPTGRIVGSLMIQPKFTRGRAVGHIEDVVVDPSYRGAGLGKALIMDLCE-ISRSKGCYK
3fb3A           -------VFCHQPTGRIVGSLMIQPKFTRGRAVGHIEDVVVDPSYRGAGLGKALIMDLCE-ISRSKGCYK


                         +         .         .         .         .         *         .:210
query           INLEAYNDKSIVLFENLGFERS
1i21B           IILDC-DEKNVKFYEKCGFSNA
1i21Y           IILDC-DEKNVKFYEKCGFSNA
1i21N           IILDC-DEKNVKFYEKCGFSNA
1i21M           IILDC-DEKNVKFYEKCGFSNA
1i21A           IILDC-DEKNVKFYEKCGFSNA
1i1dD           IILDC-DEKNVKFYEKCGFSNA
1i1dC           IILDC-DEKNVKFYEKCGFSNA
1i1dA           IILDC-DEKNVKFYEKCGFSNA
1i12D           IILDC-DEKNVKFYEKCGFSNA
1i12C           IILDC-DEKNVKFYEKCGFSNA
1i12B           IILDC-DEKNVKFYEKCGFSNA
1i12A           IILDC-DEKNVKFYEKCGFSNA
2cnmA           LWLEASNAAAIALYESLGFNEA
3i3gA           VILDS-SEKSLPFYEKLGF---
3fb3B           VILDS-SEKSLPFYEKLGF---
3fb3A           VILDS-SEKSLPFYEKLGF---