[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE0876

[Show Plain Result]

#ERROR : Can't open dsspfile "1qsmD.bssp"
#ERROR : Can't open dsspfile "1qsmB.bssp"
#ERROR : Can't open dsspfile "1qsmA.bssp"
#ERROR : Can't open dsspfile "1gheB.bssp"
#ERROR : Can't open dsspfile "1gheA.bssp"
#ERROR : Can't open dsspfile "1tiqB.bssp"
#ERROR : Can't open dsspfile "1wwzB.bssp"
#ERROR : Can't open dsspfile "1wwzA.bssp"

## Summary of PDB Search
:147
    3e-05  30%  1qsmD  [d.108.1] HPA2 HISTONE ACETYLTRANSFERASE
    3e-05  30%  1qsmB  [d.108.1] HPA2 HISTONE ACETYLTRANSFERASE
    3e-05  30%  1qsmA  [d.108.1] HPA2 HISTONE ACETYLTRANSFERASE
    4e-05  37%  1gheB  [d.108.1] ACETYLTRANSFERASE
    4e-05  37%  1gheA  [d.108.1] ACETYLTRANSFERASE
    4e-04  30%  1tiqB  [d.108.1] PROTEASE SYNTHASE AND SPORULATION NEGATIVE
    5e-04  36%  1wwzB  [x.x.x] HYPOTHETICAL PROTEIN PH1933
    5e-04  36%  1wwzA  [x.x.x] HYPOTHETICAL PROTEIN PH1933
:147

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxKEDLNECAELFVKTFSKEPWNEPWDFENAKKRLNDVVLTPGFRGAVLRNDEKIEGVILGNLE
1qsmD           ----------------------------------------------------AVESSSEKIIGMIFNHMT
1qsmB           ----------------------------------------------------AVESSSEKIIGMIFNHMT
1qsmA           ----------------------------------------------------AVESSSEKIIGMIFNHMT
1gheB           ----------------------------------------------------------------------
1gheA           ----------------------------------------------------------------------
1tiqB           --------REDLQTLQQLSIETFNDENLESAFNTEQLEKELSN-----SSQFFFIYFDHEIAGYVKVNID
1wwzB           -----------------------------------------------------VAKVGDKIVGFIVCDKD
1wwzA           -----------------------------------------------------VAKVGDKIVGFIVCDKD


                         .         .         *         .         .         .         .:140
query           QWYDGEHFCVKEFFVDSSSQGKGTGKKLLNALEDILMEKEVGVIHFWTMKGSTAEAFYNKRGYEIPKELx
1qsmD           TWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNRAQLLYVKVGYKAPKIL-
1qsmB           TWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNRAQLLYVKVGYKAPKIL-
1qsmA           TWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYWCTDESNRAQLLYVKVGYKAPKIL-
1gheB           -----------------SARGRGLGRQL-DEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGEL-
1gheA           -----------------SARGRGLGRQL-DEVEQVAVKHKRGLLHLDTEAGSVAEAFYSALAYTRVGEL-
1tiqB           QSEEGESLEIERIYIKNSFQKHGLGKHLLNKAIEIALERNKKNIWLWE-KNENAIAFYKK----------
1wwzB           WFYEGRIVAIHEFVVDKKFQGKGIGRKLLITCLDFL-GKYNDTIELWVEKNYGAMNLYEKFGFK------
1wwzA           WFYEGRIVAIHEFVVDKKFQGKGIGRKLLITCLDFL-GKYNDTIELWVEKNYGAMNLYEKFGFK------


                         +         .         .         .         .         *         .:210
query           xxxxxxx
1qsmD           -------
1qsmB           -------
1qsmA           -------
1gheB           -------
1gheA           -------
1tiqB           -------
1wwzB           -------
1wwzA           -------