[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE1028

[Show Plain Result]

#ERROR : Can't open dsspfile "2dclC.bssp"
#ERROR : Can't open dsspfile "2dclB.bssp"
#ERROR : Can't open dsspfile "2dclA.bssp"

## Summary of PDB Search
:113
    2e-08  41%  2dclC  [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503
    8e-08  38%  2dclB  [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503
    1e-07  39%  2dclA  [x.x.x] HYPOTHETICAL UPF0166 PROTEIN PH1503
:113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILARNLPX
2dclC           ---------LRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFG---KIR------LSTDLPI
2dclB           ---------LRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFGKK-----------STDLPI
2dclA           ---------LRIYIGENDKWEGRPLYKVIVEKLREMGIAGATVYRGIYGFGT--------------DLPI


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXXXXXXPMIETGTITVxxxxxxxxxxxxxx
2dclC           IVEVVDRGHNIEKVVNVIKPMIKDGMITV--------------
2dclB           IVEVVDRGHNIEKVVNVIKPMIKDGMITV--------------
2dclA           IVEVVDRGHNIEKVVNVIKPMIKDGMITV--------------