[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:pgk

[Show Plain Result]

#ERROR : Can't open dsspfile "1phpA.bssp"
#ERROR : Can't open dsspfile "1vpeA.bssp"
#ERROR : Can't open dsspfile "16pkA.bssp"
#ERROR : Can't open dsspfile "1vjdA.bssp"
#ERROR : Can't open dsspfile "1kf0A.bssp"
#ERROR : Can't open dsspfile "2zgvA.bssp"
#ERROR : Can't open dsspfile "3c3bA.bssp"
#ERROR : Can't open dsspfile "3c3aA.bssp"
#ERROR : Can't open dsspfile "3c39A.bssp"
#ERROR : Can't open dsspfile "2p9tA.bssp"
#ERROR : Can't open dsspfile "3c39B.bssp"
#ERROR : Can't open dsspfile "1hdiA.bssp"
#ERROR : Can't open dsspfile "3c3bB.bssp"
#ERROR : Can't open dsspfile "3c3aB.bssp"
#ERROR : Can't open dsspfile "1qpgA.bssp"
#ERROR : Can't open dsspfile "3pgkA.bssp"
#ERROR : Can't open dsspfile "2p9qA.bssp"
#ERROR : Can't open dsspfile "2p9qB.bssp"
#ERROR : Can't open dsspfile "1v6sA.bssp"
#ERROR : Can't open dsspfile "2paaB.bssp"
#ERROR : Can't open dsspfile "2ie8A.bssp"
#ERROR : Can't open dsspfile "1zmrA.bssp"
#ERROR : Can't open dsspfile "1ltkC.bssp"
#ERROR : Can't open dsspfile "1ltkB.bssp"
#ERROR : Can't open dsspfile "1ltkA.bssp"
#ERROR : Can't open dsspfile "1fw8A.bssp"
#ERROR : Can't open dsspfile "2cunA.bssp"
#ERROR : Can't open dsspfile "3hnpD.bssp"

## Summary of PDB Search
:397
    e-123  57%  1phpA  [x.x.x] 3-PHOSPHOGLYCERATE KINASE
    e-115  54%  1vpeA  [x.x.x] PHOSPHOGLYCERATE KINASE
    e-107  52%  16pkA  [c.86.1 (13pkA)] 3-PHOSPHOGLYCERATE KINASE
    2e-98  50%  1vjdA  [c.86.1] PHOSPHOGLYCERATE KINASE
    3e-98  50%  1kf0A  [c.86.1] PHOSPHOGLYCERATE KINASE
    2e-96  50%  2zgvA  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    3e-96  50%  3c3bA  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    5e-96  51%  3c3aA  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    6e-95  50%  3c39A  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    1e-94  48%  2p9tA  [x.x.x] PHOSPHOGLYCERATE KINASE, TESTIS SPECIFIC
    1e-94  51%  3c39B  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    2e-94  49%  1hdiA  [c.86.1] PHOSPHOGLYCERATE KINASE
    2e-94  50%  3c3bB  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    2e-94  50%  3c3aB  [x.x.x] PHOSPHOGLYCERATE KINASE 1
    7e-94  47%  1qpgA  [x.x.x] 3-PHOSPHOGLYCERATE KINASE
    1e-93  47%  3pgkA  [x.x.x] PHOSPHOGLYCERATE KINASE
    3e-91  48%  2p9qA  [x.x.x] PHOSPHOGLYCERATE KINASE, TESTIS SPECIFIC
    3e-90  48%  2p9qB  [x.x.x] PHOSPHOGLYCERATE KINASE, TESTIS SPECIFIC
    1e-89  47%  1v6sA  [c.86.1] PHOSPHOGLYCERATE KINASE
    2e-89  48%  2paaB  [x.x.x] PHOSPHOGLYCERATE KINASE, TESTIS SPECIFIC
    3e-89  47%  2ie8A  [x.x.x] PHOSPHOGLYCERATE KINASE
    2e-87  46%  1zmrA  [x.x.x] PHOSPHOGLYCERATE KINASE
    2e-84  48%  1ltkC  [c.86.1] PHOSPHOGLYCERATE KINASE
    8e-84  48%  1ltkB  [c.86.1] PHOSPHOGLYCERATE KINASE
    8e-84  48%  1ltkA  [c.86.1] PHOSPHOGLYCERATE KINASE
    7e-75  48%  1fw8A  [c.86.1] PHOSPHOGLYCERATE KINASE
    3e-58  37%  2cunA  [x.x.x] PHOSPHOGLYCERATE KINASE
    5e-04  46%  3hnpD  [x.x.x] OXIDOREDUCTASE
:397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxNKKTIEDVQVKGKKVLVRCDFNVPLKDGVITDENRLNGAMPTIKYLVDNGAKVILCSHMGKPKGEAK
1phpA           ---NKKTIRDVDVRGKRVFCRVDFNVPMEQGAITDDTRIRAALPTIRYLIEHGAKVILASHLGRPKGKVV
1vpeA           ----KMTIRDVDLKGKRVIMRVDFNVPVKDGVVQDDTRIRAALPTIKYALEQGAKVILLSHLGRPKGEPS
16pkA           ----KKSINECDLKGKKVLIRVDFNVPVKNGKITNDYRIRSALPTLKKVLTEGGSCVLMSHLGRPKGGGV
1vjdA           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAIPSIKFCLDNGAKVVLMSHLGRPDGIPM
1kf0A           ---NKLTLDKLNVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDDGAKVVLMSHLGRPDGSPM
2zgvA           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
3c3bA           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
3c3aA           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
3c39A           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
2p9tA           ----KLTLDKVDLKGKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKHCLDNGAKVVLMSHLGRPDGIPM
3c39B           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
1hdiA           ---NKLTLDKLNVKGKRVVMRVDFNVPMAAAQITNNARIKAAVPSIKFCLDDGAKVVLMSHLGRPDGSPM
3c3bB           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
3c3aB           ---NKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKVVLMSHLGRPDGVPM
1qpgA           ---SKLSVQDLDLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRVVLASHLGQPNGERN
3pgkA           ---SKLSVQDLDLKDKRVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRVVLASHLGRPNGERN
2p9qA           ----KLTLDKVDLKGKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKHCLDNGAKVVLMSHLGRPDGIPM
2p9qB           ----KLTLDKVDLKGKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKHCLDNGAKVVLMSHLGRPDGIPM
1v6sA           -----RTLLDLDPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRXXXXXXXXXXXXXXXGRPKGP-D
2paaB           ----KLTLDKVDLKGKRVIMRVDFNVPMKNNQITNNQRIKAAIPSIKHCLDNGAKVVLMSHLGRPDGIPM
2ie8A           ------TLLDLDPKGKRVLVRVDYNVPVQDGKVQDETRILESLPTLRXXXXXXXXXXXXXXXGRPKGP-D
1zmrA           ---------DLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHLGRPEGEYN
1ltkC           ---NKLSISDLKIKNKKVLVRVDFNVPIENGIIKDTNRITATLPTINHLKKEGAKIILISHCGRPDGLRN
1ltkB           ---NKLSISDLKIKNKKVLVRVDFNVPIENGIIKDTNRITATLPTINHLKKEGAKIILISHCGRPDGLRN
1ltkA           ---NKLSISDLKIKNKKVLVRVDFNVPIENGIIKDTNRITATLPTINHLKKEGAKIILISHCGRPDGLRN
1fw8A           ----------------RVFIRVDFNVPLDGKKITSNQRIVAALPTIKYVLEHHPRVVLASHLGRPNGE--
2cunA           -------LEDFNFHNKTVFLRVDLNSPMKDGKIISDARFKAVLPTIRYLIESGAKVVIGTHQGKPYSEDY
3hnpD           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           PEFSLAPVAKRLSEMLGKEVVFAADDNVVGENAKKAVAEMKDGDVVLLQNTRYRKEETKNGXXXXXXXXX
1phpA           EELRLDAVAKRLGELLERPV--AKTNEAVGDEVKAAVDRLNEGDVLLLENVRFYPGEEKNDPELAKAFAE
1vpeA           PEFSLAPVAKRLSELLGKEVKFV--PAVVGDXXXXXXXXXXXXXXXXXXNTRFHPGETKNDPELAKFWAS
16pkA           PGFTLKPVAKRLSELLLRPVTFAPDCL----NAADVVSKMSPGDVVLLENVRFYKEEAKDREAMAKILAS
1vjdA           PDYSLEPVAVELKSLLGKDVLFLKD--CVGPEVEKACADPAAGSVILLENLRFHVEEEGKGKDASGSKVK
1kf0A           PDYSLQPVAVELKSLLGKDVLFLKD--CVGPEVEKACADPAAGSVILLENLRFHVEEEGKGKDASGNKVK
2zgvA           PDYSLEPVAVELKSLLGKDVLFLKD--CVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVK
3c3bA           PDYSLEPVAVELKSLLGKDVLFLKD--CVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVK
3c3aA           PDYSLEPVAVELKSLLGKDVLFLKD--CVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVK
3c39A           PDYSLEPVAVELKSLLGKDVLFLKD--CVGPEVEKACANPAAGSVILLENLRFHXXXXXXXXXFRASLSK
2p9tA           PDYSLEPVADELKSLLNKDVIFLKD--CVGPEVEQACANPDNGSIILLENLRFHXADPAKVEAFRASLSK
3c39B           PDYSLEPVAVELKSLLGKDVLFLKDE--------KACANPAAGSVILLENLRFHVEEEGKGKDASGNKVK
1hdiA           PDYSLQPVAAELKSALGKAVLFLKD--CVGPAVEKACADPAAGSVILLENLRFHVEEEGKGKDASGNKAA
3c3bB           PDYSLEPVAVELKSLLGKDVLFLKDC------VEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVK
3c3aB           PDYSLEPVAVELKSLLGKDVLFLKD-------CVKACANPAAGSVILLENLRFHVEEEGKGKDASGNKVK
1qpgA           EKYSLAPVAKELQSLLGKDVTFLND--CVGPEVEAAVKASAPGSVILLENLRYHIEEEEDVQKFRHELSS
3pgkA           EKYSLAPVAKELQSLLGKDVTFLND--CVGPEVEAAVKASAPGSVILLENLRYHIEEEEDVQKFRHELSS
2p9qA           PDYSLEPVADELKSLLNKDVIFLKD--CVGPEVEQACANPDNGSIILLENLRFHXADPAKVEAFRASLSK
2p9qB           PDYSLEPVADELKSLLNKDVIFLKD--CVGPEVEQACANPDNGSIILLENLRFHXADPAKVEAFRASLSK
1v6sA           PKYSLAPVGEALRAHL-PEARFAPFPPG-SXXXXXXXXXXXPGEVLLLENVRFEPGEEKNDPELSARYAR
2paaB           PDYSLEPVADELKSLLNKDVIFLKD--CVGPEVEQACANPDNGSIILLENLRFHXADPAKVEAFRASLSK
2ie8A           PRYSLAPVGEALRAHL-PEARFAPFPPG-SXXXXXXXXXXXPGEVLLLENVRFEPGEEKNDPELSARYAR
1zmrA           EEFSLLPVVNYLKDKLSNPVRLVKDDGV----------DVAEGELVVLENVRFNKGEKKDDETLSKKYAA
1ltkC           EKYTLKPVAETLKGLLGEEVLFLND--CVGKEVEDKINAAKENSVILLENLRFHIEEEGKGVDANGNKVK
1ltkB           EKYTLKPVAETLKGLLGEEVLFLND--CVGKEVEDKINAAKENSVILLENLRFHIEEEGKGVDANGNKVK
1ltkA           EKYTLKPVAETLKGLLGEEVLFLND--CVGKEVEDKINAAKENSVILLENLRFHIEEEGKGVDANGNKVK
1fw8A           -KYSLAPVAKELQSLLGKDVTFLND--CVGPEVEAAVKASAPGSVILLENLRYHIEEEEDVQKFRHELSS
2cunA           T--TTEEHARVLSELLDQHVEYIED--IFGRYAREKIKELKSGEVAILENLRFSAEEVKNKPIEECEKTF
3hnpD           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXMFVNDAFGTAHRAHCSTVGVTEYLKPAVCGYLIQKELKFLGDAVETPERPFVAILGGAKVSDKINVI
1phpA           LADLYVNDAFGAAHRAHASTEGIAHYL-PAVAGFLMEKELEVLGKALSNPDRPFTAIIGGAKVKDKIGVI
1vpeA           LADIHVNDAFGTAHRAHASNVGIAQFI-PSVAGFLMEKEIKFLSKVTYNPEKPYVVVLGGAKVSDKIGVI
16pkA           YGDVYISDAFGTAHRDSATMTGIPKILGNGAAGYLMEKEISYFAKVLGNPPRPLVAIVGGAKVSDKIQLL
1vjdA           ADPVYVNDAFGTAHRAHSSMVGVN--LPKKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
1kf0A           AEPVYVNDAFGTAHRAHSSMVGVN--LPKKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
2zgvA           AEPVYVNDAFGTAHRAHSSMVGVN--LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
3c3bA           AEPVYVNDAFGTAHRAHSSMVGVN--LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
3c3aA           AEPVYVNDAFGTAHRAHSSMVGVN--LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
3c39A           LGDVYVNDAFGTAHRAHSSMVGVN--LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
2p9tA           LGDVYVNDAFGTAHRAHSSMVGVN--LPQKASGFLMKKELDYFSKALEKPERPFLAILGGAKVKDKIQLI
3c39B           AEPVYVNDAFGTAHRAHSSMVGVN--LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
1hdiA           GEPVYVNDAFGTAHRAHSSMVGVN--LPKKAGAFLMKKELNYFAAAAESPERPFLAILGGAKVADKIQLI
3c3bB           AEPVYVNDAFGTAHRAHSSMVGVN--LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
3c3aB           AEPVYVNDAFGTAHRAHSSMVGVN--LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLI
1qpgA           LADVYINDAFGTAHRAHSSMVGFD--LPQRAAGFLLEKELKYFGKALENPTRPFLAILGGAKVADKIQLI
3pgkA           LADVYINDAFGTAHRAHSSMVGFD--LPQRAAGFLLEKELKYFGKALENPTRPFLAILGGAKVADKIQLI
2p9qA           LGDVYVNDAFGTAHRAHSSMVGVN--LPQKASGFLMKKELDYFSKALEKPERPFLAILGGAKVKDKIQLI
2p9qB           LGDVYVNDAFGTAHRAHSSMVGVN--LPQKASGFLMKKELDYFSKALEKPERPFLAILGGAKVKDKIQLI
1v6sA           LGEAFVLDAFGSAHRAHASVVGVARLL-PAYAGFLMEKEVRALSRLLKDPERPYAVVLGGAKVSDKIGVI
2paaB           LGDVYVNDAFGTAHRAHSSMVGVN--LPQKASGFLMKKELDYFSKALEKPERPFLAILGGAKVKDKIQLI
2ie8A           LGEAFVLDAFGSAHRAHASVVGVARLL-PAYAGFLMEKEVRALSRLLKDPERPYAVVLGGAKVSDKIGVI
1zmrA           LCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDALGKALKEPARPMVAIVGGSKVSTKLTVL
1ltkC           ANKVFINDAFGTAHRAH-SSVGVKLNVKAS--GFL-KKELEYFSKALENPQRPLLAILGGAKVSDKIQLI
1ltkB           ANKVFINDAFGTAHRAH-SSVGVKLNVKAS--GFL-KKELEYFSKALENPQRPLLAILGGAKVSDKIQLI
1ltkA           ANKVFINDAFGTAHRAH-SSVGVKLNVKAS--GFL-KKELEYFSKALENPQRPLLAILGGAKVSDKIQLI
1fw8A           LADVYINDAFGTAHRAHSSMVGFD--LPQRAAGFLLEKELKYFGKALENPTRPFLAILGGAKVADKIQLI
2cunA           LVKKLVNDAFATAHRSQPSLVGFAR-IKPMIMGFLMEKEIEALMRAYYSKDSPKIYVLGGAKVEDSLKVV
3hnpD           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NNLLEKVDTLIIGGGMAYTFLKAQGYTVGSSLVEEDKVEYAKEMLAKAEEKGVKLLLPVDHRVAKEFKDV
1phpA           DNLLEKVDNLIIGGGLAYTFVKALGHDVGKSLLEEDKIELAKSFMEKAKEKGVRFYMPVDVVVADRFNDA
1vpeA           TNLMEKADRILIGGAMMFTFLKALGKEVGSSRVEEDKIDXXXXXXXXXXXXXXXIVLPVDAVIAQKIEPE
16pkA           DNMLQRIDYLLIGGAMAYTFLKAQGYSIGKSKCEESKLEFARSLLKKAEDRKVQVILPIDHVCHTEFKAV
1vjdA           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGSKIVKDLMSKAEKNGVKITLPVDFVTADKFDEK
1kf0A           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKNLMSKAEKNGVKITLPVDFVTADKFDEK
2zgvA           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEK
3c3bA           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEK
3c3aA           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEK
3c39A           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEK
2p9tA           KNMLDKVNFMIIGGGMAYTFLKLKNMQIGASLFDEEGATIVKEIMEKAEKNGVKIVFPVDFVTGDKFDEN
3c39B           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEK
1hdiA           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEAGKKIVKNLMSKAAANGVKITLPVDFVTADKFDEQ
3c3bB           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEK
3c3aB           NNMLDKVNEMIIGGGMAFTFLKVNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKITLPVDFVTADKFDEK
1qpgA           DNLLDKVDSIIIGGGMAFTFKKVENTEIGDSIFDKAGAEIVPKLMEKAKAKGVEVVLPVXXXXXXXXXXX
3pgkA           DNLLDKVDSIIIGGGMAFTFKKVENTEIGDSIFDKAVGPEIAKLMEKAKAKGVEVVLPVDFIIADAFSAS
2p9qA           KNMLDKVNFMIIGGGMAYTFLKLKNMQIGASLFDEEGATIVKEIMEKAEKNGVKIVFPVDFVTGDKFDEN
2p9qB           KNMLDKVNFMIIGGGMAYTFLKLKNMQIGASLFDEEGATIVKEIMEKAEKNGVKIVFPVDFVTGDKFDEN
1v6sA           ESLLPRIDRLLIGGAMAFTFLKALGGEVGRSLVEEDRLDLAKDLLGRAEALGVRVYLPEDVVAAERIEGV
2paaB           KNMLDKVNFMIIGGGMAYTFLKLKNMQIGASLFDEEGATIVKEIMEKAEKNGVKIVFPVDFVTGDKFDEN
2ie8A           ESLLPRIDRLLIGGAMAFTFLKALGGEVGRSLVEEDRLDLAKDLLGRAEALGVRVYLPEDVVAAERIEGV
1zmrA           DSLSKIADQLIVGGGIANTFIAAQGHDVGKSLYEADLVDEAKRLLTTC-----NIPVPSDVRVATEFSET
1ltkC           KNLLDKVDRII--GGGAYTFKKVLNNKIGTSLFDEAGSKIVGE-IEKAKAKNVQIFLPVDFKIADNFDNN
1ltkB           KNLLDKVDRII--GGGAYTFKKVLNNKIGTSLFDEAGSKIVGE-IEKAKAKNVQIFLPVDFKIADNFDNN
1ltkA           KNLLDKVDRII--GGGAYTFKKVLNNKIGTSLFDEAGSKIVGE-IEKAKAKNVQIFLPVDFKIADNFDNN
1fw8A           DNLLDKVDSIIIGGGMAFTFKKVENTEIGDSIFDKAGAEIVPKLMEKAKAKGVEVVLPVXXXXXXXXXXX
2cunA           ENVLERADLVLTGGLVANVFTLAKGFDLGRKNVEFDYVKHAEEIL---DEFYPYIRTPVDFAVDYKGERV
3hnpD           ----------------------------GSVIVEKDTVEHAKELLALGREKGVVVMPYQNRRFDGDFLAV


                         .         *         .         .         .         .         +:350
query           EAVVTEDQNIAEGFMGLDIGPKTEAIYAEAIKDAKTVIWNGPMGVFEFENFNKGTIAVAKAMAEADATTI
1phpA           NTKVVPIDAIPADWSALDIGPKTRELYRDVIRESKLVVWNGPMGVFEMDAFAHGTKAIAEALAEADTYSV
1vpeA           KKVVRIDDGIPEGWMGLDIGPETIELFKQKLSDAKTVVWNGPMGVFEIDDFAEGTKQVALAIAEKGAITV
16pkA           DSLITEDQNIPEGHMALDIGPKTIEKYVQTIGKCKSAIWNGPMGVFEMVPYSKGTFAIAKAMGEHGLMSI
1vjdA           TGQATVASGIPAGWMGLDCGPESSKKYSEAVARAKQIVWNGPVGVFEWEAFAQGTKALMDEVVKATSITI
1kf0A           TGQATVASGIPAGWMGLDCGPESSKKYSEAVARAKQIVWNGPVGVFEWEAFAQGTKALMDEVVKATSITI
2zgvA           TGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKA-----
3c3bA           TGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKA-----
3c3aA           TGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKATSITI
3c39A           TGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKA-----
2p9tA           AKVATIESGIPSGWMGLDCGPESIKINAQIVAQAKLIVWNGPIGVFEWDAFAKGTKALMDEVVKATSVTI
3c39B           TGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKA-----
1hdiA           AKIATVASGIPAGWMGLDCGPKSSAKYSEAVARAKQIVWNGPVGVFEWEAFAQGTKALMDEVVKATSITI
3c3bB           TGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKA-----
3c3aB           TGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFARGTKALMDEVVKA-----
1qpgA           TKTVTDKEGIPAGWQGLDNGPESRKLFAATVAKAKTIVWNGPPGVFEFEKFAAGTKALLDEVVKSSATVI
3pgkA           TKTVTDKEGIPAGWQGLDNGPESRKLFAATVAKATVILWNGPPGVFEFEKFAAGTKALLDEVVKSSATVI
2p9qA           AKVATIESGIPSGWMGLDCGPESIKINAQIVAQAKLIVWNGPIGVFEWDAFAKGTKALMDEVVKA-----
2p9qB           AKVATIESGIPSGWMGLDCGPESIKINAQIVAQAKLIVWNGPIGVFEWDAFAKGTKALMDEVVKA-----
1v6sA           ETRVFPARAIPVPYMGLDIGPKTREAFARALEGARTVFWNGPMGVFEVPPFDEGTLAVGQAIAALEAFTV
2paaB           AKVATIESGIPSGWMGLDCGPESIKINAQIVAQAKLIVWNGPIGVFEWDAFAKGTKALMDEVVKA-----
2ie8A           ETRVFPARAIPVPYMGLDIGPKTREAFARALEGARTVFWNGPMGVFEVPPFDEGTLAVGQAIAALEAFTV
1zmrA           APATLKSVNVKADEQILDIGDASAQELAEILKNAKTILWNGPVGVFEFPNFRKGTEIVANAIADSEAFSI
1ltkC           TKFVTDEEGIPDNW-GLDAGPKSIENYKDVILTSKTVIWNGPQGVFE-PNFAKGSIECLNLVVEVGAITI
1ltkB           TKFVTDEEGIPDNW-GLDAGPKSIENYKDVILTSKTVIWNGPQGVFE-PNFAKGSIECLNLVVEVGAITI
1ltkA           TKFVTDEEGIPDNW-GLDAGPKSIENYKDVILTSKTVIWNGPQGVFE-PNFAKGSIECLNLVVEVGAITI
1fw8A           TKTVTDKEGIPAGWQGLDNGPESRKLFAATVAKAKTIVWNGPPGVFEFEKFAAGTKALLDEVVKSSATVI
2cunA           EILLSENRGLLHQYQIMDIGKRTAEKYREILMKARIIVANGPMGVFEREEFAIGTVEVFKAIADSPAFSV
3hnpD           KQVV------EQGFLG------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           IGGGDSAAAVNILGFGDKMSHISTGGGASLEFLEGKVLPGIAALNDK
1phpA           IGGGDSAAAVEKFGLADKMDHISTGGGASLEFMEGKQLPGVVALEDK
1vpeA           VGGGDSAAAVNKFGLEDKFSHVSTGGGASLEFLEGKELPGIASMRIK
16pkA           IGGGDSASAAELSGEAKRMSHVSTGGGASLELLEGKTLPGVTVLDDK
1vjdA           IGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN-
1kf0A           IGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSN-
2zgvA           ----TSRGCITIIGGEDKVSHVSTGGGASLELLEGKVLPGVDALSN-
3c3bA           ----TSRGCITIIG-GDKVSHVSTGGGASLELLEGKVLPGVDALSN-
3c3aA           IGGWNTE---------DKVSHVSTGGGASLELLEGKVLPGVDALSN-
3c39A           ----TSRGCITIIG-GDKVSHVSTGGGASLELLEGKVLPGVDALSN-
2p9tA           IGGGDTATCCAKWGTEDKVSHVSTGGGASLELLEGKILPGVEALSN-
3c39B           ----TSRGCITIIG-GDKVSHVSTGGGASLELLEGKVLPGVDALSN-
1hdiA           IGGGDTATCCAKWNTEDNVSHVSTGGGASLELLEGKVLPGVDALSN-
3c3bB           ----TSRGCITIIG-GDKVSHVSTGGGASLELLEGKVLPGVDALSN-
3c3aB           ----TSRGCITIIGGEDKVSHVSTGGGASLELLEGKVLPGVDALSN-
1qpgA           IGGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPGVAFLSEK
3pgkA           IGGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPGVAFLSEK
2p9qA           ----TSNGCVTIIGGEDKVSHVSTGGGASLELLEGKILPGVEALSN-
2p9qB           ----TSNGCVTIIG-EDKVSHVSTGGGASLELLEGKILPGVEALSN-
1v6sA           VGGGDSVAAVNRLGLKERFGHVSTGGGASLEFLEKGTLPGLEVL---
2paaB           ----TSNGCVTIIG---KVSHVSTGGGASLELLEGKILPGVEALSN-
2ie8A           VGGGDSVAAVNRLGLKERFGHVSTGGGASLEFLEKGTLPGLEVL---
1zmrA           AGGGDTLAAIDLFGIADKISYISTGGGAFLEFVEGKVLPAVAMLEER
1ltkC           VGGGDTASLVEQQNKKNEISHVSTGGGASLELLEGKELPGVLALSNK
1ltkB           VGGGDTASLVEQQNKKNEISHVSTGGGASLELLEGKELPGVLALSN-
1ltkA           VGGGDTASLVEQQNKKNEISHVSTGGGASLELLEGKELPGVLALSN-
1fw8A           IGGGDTATVAKKYGVTDKISHVSTGGGASLELLEGKELPGVA-----
2cunA           LGGGHSIASIQKY-XXXXXXXXXXXXXAMLSFFAGEELPVLRAL---
3hnpD           -----------------------------------------------