[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:ddlA

[Show Plain Result]

#ERROR : Can't open dsspfile "1iovA.bssp"
#ERROR : Can't open dsspfile "1iowA.bssp"
#ERROR : Can't open dsspfile "1e4eA.bssp"
#ERROR : Can't open dsspfile "3i12A.bssp"
#ERROR : Can't open dsspfile "1e4eB.bssp"
#ERROR : Can't open dsspfile "3i12D.bssp"
#ERROR : Can't open dsspfile "3i12C.bssp"
#ERROR : Can't open dsspfile "3i12B.bssp"
#ERROR : Can't open dsspfile "2i80B.bssp"
#ERROR : Can't open dsspfile "2i80A.bssp"
#ERROR : Can't open dsspfile "2zdhA.bssp"
#ERROR : Can't open dsspfile "2fb9A.bssp"
#ERROR : Can't open dsspfile "2i87B.bssp"
#ERROR : Can't open dsspfile "1ehiA.bssp"
#ERROR : Can't open dsspfile "2yznA.bssp"
#ERROR : Can't open dsspfile "1ehiB.bssp"
#ERROR : Can't open dsspfile "2zdhC.bssp"
#ERROR : Can't open dsspfile "2zdgB.bssp"
#ERROR : Can't open dsspfile "2yznB.bssp"
#ERROR : Can't open dsspfile "3e5nA.bssp"
#ERROR : Can't open dsspfile "2zdgA.bssp"
#ERROR : Can't open dsspfile "2zdhB.bssp"
#ERROR : Can't open dsspfile "2yznC.bssp"
#ERROR : Can't open dsspfile "2yzmB.bssp"
#ERROR : Can't open dsspfile "2yzmC.bssp"
#ERROR : Can't open dsspfile "2yzgA.bssp"
#ERROR : Can't open dsspfile "2zdgD.bssp"
#ERROR : Can't open dsspfile "2yzgC.bssp"
#ERROR : Can't open dsspfile "2yzgB.bssp"
#ERROR : Can't open dsspfile "2pvpA.bssp"
#ERROR : Can't open dsspfile "2pvpB.bssp"
#ERROR : Can't open dsspfile "1vkzA.bssp"
#ERROR : Can't open dsspfile "1bxrA.bssp"
#ERROR : Can't open dsspfile "1m6vA.bssp"
#ERROR : Can't open dsspfile "2qk4A.bssp"
#ERROR : Can't open dsspfile "1ce8A.bssp"
#ERROR : Can't open dsspfile "1c30A.bssp"
#ERROR : Can't open dsspfile "2qk4B.bssp"
#ERROR : Can't open dsspfile "1jdbK.bssp"
#ERROR : Can't open dsspfile "2dzdB.bssp"

## Summary of PDB Search
:301
    5e-49  36%  1iovA  [x.x.x] D-ALA\:D-ALA LIGASE
    1e-48  36%  1iowA  [x.x.x] D-ALA\:D-ALA LIGASE
    6e-41  37%  1e4eA  [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
    1e-40  35%  3i12A  [x.x.x] D-ALANINE-D-ALANINE LIGASE A
    1e-39  36%  1e4eB  [c.30.1 - d.142.1] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE
    5e-39  34%  3i12D  [x.x.x] D-ALANINE-D-ALANINE LIGASE A
    3e-38  35%  3i12C  [x.x.x] D-ALANINE-D-ALANINE LIGASE A
    5e-38  35%  3i12B  [x.x.x] D-ALANINE-D-ALANINE LIGASE A
    1e-33  36%  2i80B  [x.x.x] D-ALANINE-D-ALANINE LIGASE
    1e-33  36%  2i80A  [x.x.x] D-ALANINE-D-ALANINE LIGASE
    4e-32  34%  2zdhA  [x.x.x] D-ALANINE--D-ALANINE LIGASE
    4e-32  34%  2fb9A  [x.x.x] D-ALANINE:D-ALANINE LIGASE
    6e-32  36%  2i87B  [x.x.x] D-ALANINE-D-ALANINE LIGASE
    6e-32  34%  1ehiA  [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
    1e-30  33%  2yznA  [x.x.x] D-ALANINE-D-ALANINE LIGASE
    2e-30  34%  1ehiB  [c.30.1 - d.142.1] D-ALANINE:D-LACTATE LIGASE
    5e-30  34%  2zdhC  [x.x.x] D-ALANINE--D-ALANINE LIGASE
    3e-29  34%  2zdgB  [x.x.x] D-ALANINE--D-ALANINE LIGASE
    1e-28  34%  2yznB  [x.x.x] D-ALANINE-D-ALANINE LIGASE
    1e-28  34%  3e5nA  [x.x.x] D-ALANINE-D-ALANINE LIGASE A
    2e-28  34%  2zdgA  [x.x.x] D-ALANINE--D-ALANINE LIGASE
    3e-28  33%  2zdhB  [x.x.x] D-ALANINE--D-ALANINE LIGASE
    3e-28  35%  2yznC  [x.x.x] D-ALANINE-D-ALANINE LIGASE
    6e-28  35%  2yzmB  [x.x.x] D-ALANINE--D-ALANINE LIGASE
    1e-27  34%  2yzmC  [x.x.x] D-ALANINE--D-ALANINE LIGASE
    4e-27  33%  2yzgA  [x.x.x] D-ALANINE--D-ALANINE LIGASE
    7e-27  34%  2zdgD  [x.x.x] D-ALANINE--D-ALANINE LIGASE
    3e-23  35%  2yzgC  [x.x.x] D-ALANINE--D-ALANINE LIGASE
    5e-23  35%  2yzgB  [x.x.x] D-ALANINE--D-ALANINE LIGASE
    2e-19  30%  2pvpA  [x.x.x] D-ALANINE-D-ALANINE LIGASE
    1e-16  31%  2pvpB  [x.x.x] D-ALANINE-D-ALANINE LIGASE
    3e-10  26%  1vkzA  [c.30.1 - d.142.1 - b.84.2] PHOSPHORIBOSYLAMINE--GLYCINE
    1e-05  23%  1bxrA  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    3e-05  25%  1m6vA  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    4e-05  24%  2qk4A  [x.x.x] TRIFUNCTIONAL PURINE BIOSYNTHETIC PROTEIN
    4e-05  25%  1ce8A  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    4e-05  25%  1c30A  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    2e-04  24%  2qk4B  [x.x.x] TRIFUNCTIONAL PURINE BIOSYNTHETIC PROTEIN
    2e-04  24%  1jdbK  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    8e-04  36%  2dzdB  [x.x.x] PYRUVATE CARBOXYLASE
:301

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVGVIMGGISSEREISIQSGNSVVHALDKDKYEAIPIVLNEKEDLIEKVKGIDFALLALHGKFGEDGTV
1iovA           -KIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDGTL
1iowA           -KIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFIALHGRGGEDGTL
1e4eA           IKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGITENENLVKKINHVDVAFSALHGKSGEDGSI
3i12A           LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGINDAENYLQQVPGVDVIFPIVHGTLGEDGSL
1e4eB           IKVAILFGGCSEEHDVSVKSAIEIAANINKEKYEPLYIGITENENLVKKINHVDVAFSALHGKSGEDGSI
3i12D           LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGINDAENYLQQVPGVDVIFPIVHGTLGEDGSL
3i12C           LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGINDAENYLQQVPGVDVIFPIVHGTLGEDGSL
3i12B           LRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTRFDVVLLGINDAENYLQQVPGVDVIFPIVHGTLGEDGSL
2i80B           ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
2i80A           ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGPNGEDGTI
2zdhA           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
2fb9A           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
2i87B           ----IVFGGKSAEHEVSILTAQNVLNAIDKDKYHVDIIYITNDGDITAEIKSTDELHLELHGP--EDGTI
1ehiA           -RVALIFGGNSSEHDVSKRSAQNFYNAIEATKYEIIVLALEDEQPIVDSAGDFDIFFPVVHGNLGEDGTL
2yznA           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
1ehiB           -RVALIFGGNSSEHDVSKRSAQNFYNAIEATKYEIIVLALEDEQPIVDSAGDFDIFFPVVHGNLGEDGTL
2zdhC           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
2zdgB           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
2yznB           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
3e5nA           IRVGLIFGGKSAEHEVSLQSARNILDALDPQRFEPVLIGIDKQGQLHRSGRGVDVVFPIVHGTLGEDGSL
2zdgA           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
2zdhB           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
2yznC           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
2yzmB           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
2yzmC           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
2yzgA           -----------------------------------------------------DVVFPLLHGRFGEDGTV
2zdgD           MRVLLIAGGVSPEHEVSLLSAEGVLRHIPEGEHPFPPPLSWERYDVV-------FPLL--HGRFGEDGTV
2yzgC           -----------------------------------------------------DVVFPLLHGRFGEDGTV
2yzgB           -----------------------------------------------------DVVFPLLHGRFGEDGTV
2pvpA           MEFCVLFGGASFEHEISIVSAIALKGVLDRIKYKLPPLILTKNSFLGAKIIELPLVINLVHGGDGEDGKL
2pvpB           MEFCVLFGGASFEHEISIVSAIALKGVLDRIKYKLPPLILTKNSFLGAKIIELPLVINLVHGGDGEDGKL
1vkzA           ----------------------------------------------------------------------
1bxrA           ----------------------------------------------------------------------
1m6vA           ----------------------------------------------------------------------
2qk4A           -------------KQVLVAPGNAGTACSEKISNTAISISDHTALAQFCKEKKIEFVVVGPEAPLAAG--I
1ce8A           ----------------------------------------------------------------------
1c30A           ----------------------------------------------------------------------
2qk4B           -------------KQVLVAPGNAGTACSEKISNTAISISDHTALAQFCKEKKIEFVVVGPEAPLAAG--I
1jdbK           ----------------------------------------------------------------------
2dzdB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QSVLKTLGIPFSGCGPLSSAICMDKDMTKRILAFGNVRTARWEMVSSVDEIDYEKIENLGYPVFVKPNNG
1iovA           QGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWEFEKGLSDKQLAEISALGLPVIVKPSRE
1iowA           QGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWEFEKGLSDKQLAEISALGLPVIVKPSRE
1e4eA           QGLFELSGIPFVGCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDR---PVAATFTYPVFVKPARS
3i12A           QGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRFSFAEVESLGLPLFVKPANQ
1e4eB           QGLFELSGIPFVGCDIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDR---PVAATFTYPVFVKPARS
3i12D           QGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRFSFAEVESLGLPLFVKPANQ
3i12C           QGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRFSFAEVESLGLPLFVKPANQ
3i12B           QGMLRVANLPFVGSDVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRFSFAEVESLGLPLFVKPANQ
2i80B           QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
2i80A           QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
2zdhA           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2fb9A           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2i87B           QGLFEVLDVPYVGNGVLSAASSMDKLVMKQLFEHRGLPQLPY---ISFLRSEYEKYEHLNYPVFVKPANL
1ehiA           QGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVESANNWSWDKIAELGNIVFVKAANQ
2yznA           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRK------GEXXXXXXXXXXXXXXA
1ehiB           QGLFKLLDKPYVGAPLRGHAVSFDKALTKELLTVNGIRNTKYIVVESANNWSWDKIAELGNIVFVKAANQ
2zdhC           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2zdgB           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2yznB           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
3e5nA           QGLLRMANLPFVGSGVLGSAVAMDKDMAKRVLRDARLAVAPFRHTAAHADVD-TLIAQLGLPLFVKPANQ
2zdgA           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2zdhB           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2yznC           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2yzmB           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2yzmC           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2yzgA           QGFLELLGKPYVGAGVAASALC-DKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2zdgD           QGFLELLGKPYVGAGVAASALCMDKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2yzgC           QGFLELLGKPYVGAGVAASALC-DKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2yzgB           QGFLELLGKPYVGAGVAASALC-DKDLSKRVLAQAGVPVVPWVAVRKGE----XXXXXXXXXXXXXXANT
2pvpA           ASLLEFYRIAFIGPRIEASVLSYNKYLTKLYAKDLGIKTLDYVLLNEKNRANALDLMNFNFPFIVKPSNA
2pvpB           ASLLEFYRIAFIGPRIEASVLSYNKYLTKLYAKDLGIKTLDYVLLNEKNRANALDLMNFNFPFIVKPSNA
1vkzA           --------------GPVKEVARLEKVYAKRFKKYG-IRTARFEVAETPEELR-EKIKKFSPPYVIKADGL
1bxrA           ---LEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAI-EMAVEKAKEIGYPLVVRPSYG
1m6vA           ---LEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAI-EMAVEKAKEIGYPLVVRPS--
2qk4A           VGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEA-CSFILSADFPALVVKASG
1ce8A           ---LEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAI-EMAVEKAKEIGYPLVVRP---
1c30A           ---LEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAI-EMAVEKAKEIGYPLVVRP---
2qk4B           VGNLRSAGVQCFGPTAEAAQLESSKRFAKEFMDRHGIPTAQWKAFTKPEEA-CSFILSADFPALVVKASG
1jdbK           ---LEAAGVPVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAI-EMAVEKAKEIGYPLVVRP---
2dzdB           -----------------------------------------------------------GYPIIIKAALG


                         +         .         .         .         .         *         .:210
query           GSSVATTLVESKEAVKDAVLEALKYDTEVMIEEYIKGDEITCPIIDGKMLPVLAIKPKGKFFDIASKYGD
1iovA           GSSVGMSKVVAENALQDALRLAFQHDEEVLIEKWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAKYLS
1iowA           GSSVGMSKVVAENALQDALRLAFQHDEEVLIEKWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAKFLS
1e4eA           GSSFGVKKVNSADELDYAIESARQYDSKILIEQAVSGCEVGCAVLGNSAALVV-----GEVDQIRLQYGE
3i12A           GSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVL-GNDNPQASIVLNSEFYD--TKYID
1e4eB           GSSFGVKKVNSADELDYAIESARQYDSKILIEQAVSGCEVGCAVLGNSAALVV-----GEVDQIRLQYGE
3i12D           GSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVL-GNDNP--QASTCGEIVLNSEFYID
3i12C           GSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVL-------------GNDNPQASTCGE
3i12B           GSSVGVSKVANEAQYQQAVALAFEFDHKVVVEQGIKGREIECAVL-------------GNDNPQASTCGE
2i80B           GSSVGISKCNNEAELKEGIKEAFQFDRKLVIEQGVNAREIEVAVL-GNDYPE-ATWPGEVVKDVAFVQLQ
2i80A           GSSVGISKCNNEAELKEGIKEAFQFDRKLVIEQGVNAREIEVAVL-GNDYPE-ATWPGEVVKDVAFVQLQ
2zdhA           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPRELEVGVLGGEASPVGEVRYEAPFYDYETKYTP
2fb9A           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPRELEVGVLGGEASPVGEVRYEAPFYDYETKYTP
2i87B           GSSVGISKCNNEAELKEGIKEAFQFDRKLVIEQGVNAREIEVAVL-GNDYPE-ATWPGEVVKDVAFVQLQ
1ehiA           GSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGARELEVGVIGNDQPLVSVPNQGSWYDYNNKFVD
2yznA           NTSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPRELEVGVLGGEASPVGEVRYEAPFYDYETKYTP
1ehiB           GSSVGISRVTNAEEYTEALSDSFQYDYKVLIEEAVNGRELEVGVIGNDQPLVSEIGAHTVHFQIPA----
2zdhC           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPRELEVGVLGGEASPVGEVRYEAPFY---TKYTP
2zdgB           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE
2yznB           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPRELEVGVLGGEASPVGEVRYEAPF------YTP
3e5nA           GSSVGVSQVRTXXXXXXXXXXXXXYDHKVLVEAAVAGREIECAVL-GNAVPHASV---------------
2zdgA           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE
2zdhB           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPRELEVGVLGGEASPVGEVRYEAPFY-------P
2yznC           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE
2yzmB           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE
2yzmC           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE
2yzgA           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALSPRELEVGVLGGEASPVGEVRYEAPFYDYETKYTP
2zdgD           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE
2yzgC           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE
2yzgB           GSSVGISRVERFQDLEAALALAFRYDEKAVVEKALS------PVRE------LEVGVLGNVFGEASPVGE
2pvpA           GSSLGVNVVKEEKELIYALDSAFEYSKEVLIEPFIQGNLAGCKIKKDFCFSYIEEPNKQEFLDFKQKYLD
2pvpB           GSSLGVNVVKEEKELIYALDSAFEYSKEVLIEPFIQG---------VKEYNLAGCKIKKDF---------
1vkzA           ARGKGVLILDSKEETKLIIGELIKVKGPVVIDEFLAGNELSAAVVNGRNFVILPFVRDYKRLDGDRGPNT
1bxrA           GRAMEIVYDEADLRRYFQTAVSVSNDAPVLLDHFLDDEVDVDAICDGEMVLIGGIMEHIEQAGVHS--GD
1m6vA           ----------AMEIVYDEADLRRYFQTAVLLDHFLDDEVDVDAICDGEMVLIGGIMEHIEQAGVHS--GD
2qk4A           LKGVI--VAKSKEEACKAVQEIMQEET-IVIEELLDGEEVSCCFTDGK----------------------
1ce8A           ----------AMEIVYDEADLRRYFQTAVLLDHFLDDEVDVDAICDGEMVLIGGIMEHIEQAGVHS--GD
1c30A           ----------AMEIVYDEADLRRYFQTAVLLDHFLDDEVDVDAICDGEMVLIGGIMEHIEQAGVHS--GD
2qk4B           GVIVAKSKEEACKAVQEIMQE--KAGETIVIEELLDGEEVSCCFTDGK----------------------
1jdbK           ----AMEIVYDEADLRRYFQTAAPVLLDHFLDDAVEVD--VDAICDGEMVLIGGIMEHIEQAGVHS--GD
2dzdB           GGGRGMRIVRSKSEVKEAFERAKSEAKEVYVEKLIE----------------------------------


                         .         .         .         +         .         .         .:280
query           GGADEFIVELNEDLHKEVEKMALETYKLLKCDVYARVDMLVKDNIPYVLEVNTLPGMTKNSLFPKSAAGI
1iovA           DETQYFCAGLEASQEANLQALVLKAWTTLGCKGWGRIDMLDSDGQFYLLEANTSPGMTSHSLVPMAARQA
1iowA           DETQYFCAGLEASQEANLQALVLKAWTTLGCKGWGRIDMLDSDGQFYLLEANTSPGMTSHSLVPMAARQA
1e4eA           KGSENAVITVPADLSAEIQETVKKIYKTLGCRGLARVDMFLQDNGRIVLEVNTLPGFTSYSRYPRMMAAA
3i12A           DNGAQVVVQIPSEVNDKIRAIAIQAYQTLGCAGMARVDVLTADNEVVINEINTLPGFTNISMYPKLWQAS
1e4eB           KGSENAVITVPADLSAEIQETVKKIYKTLGCRGLARVDMFLQDRGRIVLEVNTLPGFTSYSRYPRMMAAA
3i12D           DNGAQVVVQIPSEVNDKIRAIAIQAYQTLGCAGMARVDVLTADNEVVINEINTLPGFTNISMYPKLWQAS
3i12C           GAQVVVPAQIPSEVNDKIRAIAIQAYQTLGCAGMARVDVLTADNEVVINEINTLPGFTNISMYPKLWQAS
3i12B           IVLQVVVAQIPSEVNDKIRAIAIQAYQTLGCAGMARVDVLTADNEVVINEINTLPGFTNISMYPKLWQAS
2i80B           IPAD-----LDEDVQLTLRNMALEAFKATDCSGLVRADFFVEDNQIYINETNAMPGFTAFSMYPKLWENM
2i80A           IPAD-----LDEDVQLTLRNMALEAFKATDCSGLVRADFFVEDNQIYINETNAMPGFTAFSMYPKLWENM
2zdhA           GRAELLIAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
2fb9A           GRAELLIAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
2i87B           IPAD-----LDEDVQLTLRNMALEAFKATDCSGLVRADFFVEDNQIYINETNAMPGFTAFSMYPKLWENM
1ehiA           NSAVHFQIQLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLENNVPYLGEPNTLPGFTNMSLFKRLWDYS
2yznA           GRAELLIAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
1ehiB           --------QLSPEVTKEVKQMALDAYKVLNLRGEARMDFLLENNVPYLGEPNTLPGFTNMSLFKRLWDYS
2zdhC           GRAELLIAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
2zdgB           VRYEELLIPAPLDTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
2yznB           GRAELLIAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
3e5nA           --CGEVVVEIXXXXXXXXXXXXXXXXXXLGCAGMARVDVLCADGRIVINEVNTLPGFTRISVYPKLWQAS
2zdgA           VRELLIPAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
2zdhB           GRAELLIAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
2yznC           GRAELLIAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
2yzmB           GRAELLIAPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
2yzmC           APRAELLIPLDPGTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
2yzgA           GRAELLIAPLDPGTQETVQELALKAYKVLGVR-GARVDFFLAEGELYLNELNTIPGFTPTS-YPRLFEAG
2zdgD           EAPAELLIPA-PLTQETVQELALKAYKVLGVRGMARVDFFLAEGELYLNELNTIPGFTPTSMYPRLFEAG
2yzgC           GRAELLIAPLDPGTQETVQELALKAYKVLGVR-GARVDFFLAEGELYLNELNTIPGFTPTS-YPRLFEAG
2yzgB           GRAELLIAPLDPGTQETVQELALKAYKVLGVR-GARVDFFLAEGELYLNELNTIPGFTPTS-YPRLFEAG
2pvpA           FSRNK---APKASLSNALEEQLKENFKKLYSDLFIRCDFFVIENEVYLNEINPIPGSLANYLF-------
2pvpB           --CFSYIEEPNKSLSNALEEQLKENFKKLYSDLFIRCDFFVIENEVYLNEINPIPGSLANYLF-------
1vkzA           GGGSWGPVEIPSDTIKKIEELFDKTLWGVEKEGYAYRGFLLHDGDPYILEYNVRLG------DPETEVIV
1bxrA           SAAYTLSQEIQDVMRQQVQKLAFE----LQVRGLMNVQFAVKNNEVYLIEVN--PRAARTVPFVSKATGV
1m6vA           SAAYTLSQEIQDVMRQQVQKLAFE----LQVRGLMNVQFAVKNNEVYLIEVN--PRAARTVPFVSKATGV
2qk4A           ----------------------------------------------------------------------
1ce8A           SAAYTLSQEIQDVMRQQVQKLAFE----LQVRGLMNVQFAVKNNEVYLIEVN--PRAARTVPFVSKATGV
1c30A           SAAYTLSQEIQDVMRQQVQKLAFE----LQVRGLMNVQFAVKNNEVYLIEVN--PRAARTVPFVSKATGV
2qk4B           ----------------------------------------------------------------------
1jdbK           SAAYTLSQEIQDVMRQQVQKLAFE----LQVRGLMNVQFAVKNNEVYLIEVN--PRAARTVPFVSKATGV
2dzdB           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NMSFEELLDTIIEKSLKxxxx
1iovA           GMSFSQLVVRILE--------
1iowA           GMSFSQLVVRILE--------
1e4eA           GISLPELIDRLIVLALK----
3i12A           GLGYTDLISRLIELALE----
1e4eB           GISLPELIDRLIVLAL-----
3i12D           GLGYTDLISRLIELALE----
3i12C           GLGYTDLISRLIELALE----
3i12B           GLGYTDLISRLIELALE----
2i80B           GLSYPELITKLIE--------
2i80A           GLSYPELITKLIE--------
2zdhA           GVAYPELLRRLVELAL-----
2fb9A           GVAYPELLRRLVELAL-----
2i87B           GLSYPELITKLIE--------
1ehiA           DINNAKLVDMLID--------
2yznA           GVAYPELLRRLVELAL-----
1ehiB           DINNAKLVDMLID--------
2zdhC           GVAYPELLRRLVELAL-----
2zdgB           GVAYPELLRRLVELAL-----
2yznB           GVAYPELLRRLVELAL-----
3e5nA           GLDYRGLITRLIELALE----
2zdgA           GVAYPELLRRLVELAL-----
2zdhB           GVAYPELLRRLVELAL-----
2yznC           GVAYPELLRRLVELAL-----
2yzmB           GVAYPELLRRLVELAL-----
2yzmC           GVAYPELLRRLVELAL-----
2yzgA           GVAYPELLRRLVELAL-----
2zdgD           GVAYPELLRRLVELAL-----
2yzgC           GVAYPELLRRLVELAL-----
2yzgB           GVAYPELLRRLVELAL-----
2pvpA           ---------------------
2pvpB           ---------------------
1vkzA           TLNPEGFVNAVLE--------
1bxrA           PLA------------------
1m6vA           PLA------------------
2qk4A           ---------------------
1ce8A           PLA------------------
1c30A           PLA------------------
2qk4B           ---------------------
1jdbK           PLA------------------
2dzdB           ---------------------