[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:hemA

[Show Plain Result]

#ERROR : Can't open dsspfile "1gpjA.bssp"
#ERROR : Can't open dsspfile "3fbtC.bssp"
#ERROR : Can't open dsspfile "3fbtA.bssp"
#ERROR : Can't open dsspfile "1yb3A.bssp"

## Summary of PDB Search
:400
    3e-20  32%  1gpjA  [d.58.39 - c.2.1 - a.151.1] GLUTAMYL-TRNA REDUCTASE
    5e-04  30%  3fbtC  [x.x.x] CHORISMATE MUTASE AND SHIKIMATE 5-DEHYDROGENASE
    5e-04  30%  3fbtA  [x.x.x] CHORISMATE MUTASE AND SHIKIMATE 5-DEHYDROGENASE
    8e-04  31%  1yb3A  [x.x.x] HYPOTHETICAL PROTEIN
:400

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxYPKKHKKYVGELLNSFKEVVILNTCNRTEIYFNCTEEISEDEIFDKIFN
1gpjA           ----------------------------------------VLLQTSNRVEVYASGARDRAE-ELGDLI--
3fbtC           ----------------------------------------------------------------------
3fbtA           ----------------------------------------------------------------------
1yb3A           ---------------------FPKEEKEFIEDVIRAFEKLFIYGAENFLEDFYNFEHPISGDEVWDRIVN


                         .         .         *         .         .         .         .:140
query           VFNWNDDLKKYMFLSKEKRAVTHLMEVICGFHSRILGEDQILGQIKDAYKTAISDNSISSELQKMFEIAI
1gpjA           ----HDDA----WVKRGSEAVRHLFRVASGLESMMVGEQEILRQVKKAYDRAARLGTLDEALKIVFRRAI
3fbtC           ----------------------------------------------------------------------
3fbtA           ----------------------------------------------------------------------
1yb3A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ACGKKFKTECKMFEVPXXXXXXXXXXALLKGCRKFMVLGYGEIGKLAIKHLLSHKVECIYLIVRDKSKAS
1gpjA           NLGKRAREETRISEGAVSIGSAAVELAEREHDKTVLVVGAGEMGKTVAKSLVDRGVRAVLVANRTYERAV
3fbtC           -----------------------------------VVLGSGGAARAVLQYLKDNFAKDIYVVTRNPEKTS
3fbtA           -----------------------------------VVLGSGGAARAVLQYLKDNFAKDIYVVTRNPEKTS
1yb3A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DLEGEIVEVLDFNEKNQVINEVDCIVSCTAAPHTVVRNEDIKTEGDIIHIYDLAVPRDVDKELSEKERVx
1gpjA           ELARDLGEAVRFDELVDHLARSDVVVSATAAPHPVIHVDDVRDRRSPILIIDIANPRDVEEGVENIEDV-
3fbtC           EIYGEF-KVISYDELSNL--KGDVIINCT-----------------------------------------
3fbtA           EIYGEF-KVISYDELSNL--KGDVIINCT-----------------------------------------
1yb3A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1gpjA           ----------------------------------------------------------------------
3fbtC           ----------------------------------------------------------------------
3fbtA           ----------------------------------------------------------------------
1yb3A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1gpjA           --------------------------------------------------
3fbtC           --------------------------------------------------
3fbtA           --------------------------------------------------
1yb3A           --------------------------------------------------