[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:asrC.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c7bA.bssp"
#ERROR : Can't open dsspfile "2akjA.bssp"
#ERROR : Can't open dsspfile "3c7bB.bssp"
#ERROR : Can't open dsspfile "1fehA.bssp"
#ERROR : Can't open dsspfile "2v4jA.bssp"
#ERROR : Can't open dsspfile "2fdnA.bssp"
#ERROR : Can't open dsspfile "1clfA.bssp"
#ERROR : Can't open dsspfile "1fcaA.bssp"
#ERROR : Can't open dsspfile "1kqfB.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1zj8A.bssp"
#ERROR : Can't open dsspfile "1hfeL.bssp"
#ERROR : Can't open dsspfile "7gepA.bssp"
#ERROR : Can't open dsspfile "3geoA.bssp"
#ERROR : Can't open dsspfile "2gepA.bssp"
#ERROR : Can't open dsspfile "1gep-.bssp"
#ERROR : Can't open dsspfile "1geo-.bssp"
#ERROR : Can't open dsspfile "1e08A.bssp"
#ERROR : Can't open dsspfile "4aopA.bssp"
#ERROR : Can't open dsspfile "1aopA.bssp"
#ERROR : Can't open dsspfile "2v4jB.bssp"
#ERROR : Can't open dsspfile "1jb0C.bssp"
#ERROR : Can't open dsspfile "1k0tA.bssp"
#ERROR : Can't open dsspfile "2o01C.bssp"
#ERROR : Can't open dsspfile "1durA.bssp"
#ERROR : Can't open dsspfile "1fdx-.bssp"

## Summary of PDB Search
:326
    2e-13  30%  3c7bA  [x.x.x] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    8e-10  31%  2akjA  [x.x.x] FERREDOXIN--NITRITE REDUCTASE, CHLOROPLAST
    9e-07  26%  3c7bB  [x.x.x] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    2e-06  43%  1fehA  [d.15.4 - d.58.1 - c.96.1] PROTEIN (PERIPLASMIC HYDROGENASE
    4e-06  27%  2v4jA  [x.x.x] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    6e-06  43%  2fdnA  [x.x.x] FERREDOXIN
    6e-06  45%  1clfA  [x.x.x] FERREDOXIN
    1e-05  43%  1fcaA  [x.x.x] FERREDOXIN
    2e-05  29%  1kqfB  [d.58.1 - f.23.22] FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE,
    5e-05  38%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-05  28%  1zj8A  [x.x.x] PROBABLE FERREDOXIN-DEPENDENT NITRITE REDUCTASE
    1e-04  31%  1hfeL  [d.58.1 - c.96.1] PROTEIN (FE-ONLY HYDROGENASE
    1e-04  31%  7gepA  [x.x.x] SULFITE REDUCTASE HEMOPROTEIN
    1e-04  31%  3geoA  [x.x.x] SULFITE REDUCTASE HEMOPROTEIN
    1e-04  31%  2gepA  [x.x.x] SULFITE REDUCTASE HEMOPROTEIN
    1e-04  31%  1gep-  [x.x.x] SULFITE REDUCTASE HEMOPROTEIN
    1e-04  31%  1geo-  [x.x.x] SULFITE REDUCTASE HEMOPROTEIN
    1e-04  31%  1e08A  [i.4.1] [FE]-HYDROGENASE (LARGE SUBUNIT)
    1e-04  31%  4aopA  [x.x.x] SULFITE REDUCTASE HEMOPROTEIN
    1e-04  31%  1aopA  [x.x.x] SULFITE REDUCTASE HEMOPROTEIN
    1e-04  22%  2v4jB  [x.x.x] SULFITE REDUCTASE, DISSIMILATORY-TYPE SUBUNIT
    1e-04  35%  1jb0C  [d.58.1] PHOTOSYSTEM I IRON-SULFUR CENTER
    2e-04  35%  1k0tA  [d.58.1] PSAC SUBUNIT OF PHOTOSYSTEM I
    3e-04  35%  2o01C  [x.x.x] PHOTOSYSTEM I IRON-SULFUR CENTER
    4e-04  37%  1durA  [d.58.1] 2[4FE-4S] FERREDOXIN
    7e-04  36%  1fdx-  [x.x.x] FERREDOXIN
:326

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxKRRGYTASRIRVPGGHLDAKLLLNIQEIADTYGDGTVHITTRQGFEIPGIDM
3c7bA           --------------------------RINQPSGWFSTKALRGLCDVWEKWGSGLTNFHGSTG------DI
2akjA           ------------------KQQGLSFVGLHIPVGRLQADEMEELARIADVYGSGELRLTVEQNIIIPNVE-
3c7bB           --------------------------------------------DIADKYSDGYLRWTSRNNVEFFVTDE
1fehA           ----------------------------------------------------------------------
2v4jA           --------------------------RVAQPSGYYSADYLRQLCDIWDLRGSGLTNMHGSTG------DI
2fdnA           ----------------------------------------------------------------------
1clfA           ----------------------------------------------------------------------
1fcaA           ----------------------------------------------------------------------
1kqfB           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1zj8A           ----------------------YFMMRVRCDGGALSAAALRTLGQISTEFARDTADISDRQNVQYHWIEV
1hfeL           ----------------------------------------------------------------------
7gepA           ----------------------------------------------------------------------
3geoA           ----------------------------------------------------------------------
2gepA           ----------------------------------------------------------------------
1gep-           ----------------------------------------------------------------------
1geo-           ----------------------------------------------------------------------
1e08A           ----------------------------------------------------------------------
4aopA           ----------------------------------------------------------------------
1aopA           ----------------------------------------------------------------------
2v4jB           --------------------------------------------DIADKYCGGHLRFTTRNNVEFMVAD-
1jb0C           ----------------------------------------------------------------------
1k0tA           ----------------------------------------------------------------------
2o01C           ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
1fdx-           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KDIPEVNKKLQPIIEALEINQENPGDGYNAAGTRNVSACIGNNVCPFANYNTTNFAKKIEKAIFPNDLHF
3c7bA           IFLGTRSEYLQPCFEDLG-NLEIPFDGGSGSDLRTPSACMGPALCEFACYDTLELCYDLTMT-YQDELHF
2akjA           ------NSKIDSLLEPLLKERYSPEPPILMKG---LVACTGSQFCGQAIIETKARALKVTEEVRPVRMHW
3c7bB           SKIDDLINEVQ---ERVGFPCGGTWDAVKGEGLSNIVHTQGWIHCHTPAIDASGIVKAVMDELYEYFTDH
1fehA           ----------------------------------------------------------------------
2v4jA           VLLGTQTPQLEEIFFELTHNL-NTDLGGSGSNLRTPESCLGKSRCEFACYDTMEYQDELHRPAFP--YKF
2fdnA           ----------------------------------------------------------------------
1clfA           ----------------------------------------------------------------------
1fcaA           ----------------------------------------------------------------------
1kqfB           ----------------------------------DVSTCIGCKACQVACSEWNDIRDEVGHCVGPADLSA
3bk7A           ----------------------------------------------------------------------
1zj8A           ENVPEIWRRLDDV---------------------------------------------------------
1hfeL           ----------------------------------------------------------------------
7gepA           ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
3geoA           ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
2gepA           ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
1gep-           ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
1geo-           ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
1e08A           ----------------------------------------------------------------------
4aopA           ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
1aopA           ----------------------------------NSMACVSFPTCPLAMAEAERFLPSFIDNIDNSDEHI
2v4jB           ------EASLKALKEDLASRKFDGGSGGTGAGVSNIVHTQGWVHCHTPATDASGPVKAIMDEVFEDPAPV
1jb0C           ----------------------------------------------------------------------
1k0tA           ----------------------------------------------------------------------
2o01C           ----------------------------------------------------------------------
1durA           ----------------------------------------------------------------------
1fdx-           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KIALTGCPNDCIKARMHDFGIIGMTEPQYERNRCVSCGACVRACKKKATGALSFENFKVVRDGSKCIGCG
3c7bA           KIKCAGCPNDCVASKARDFAIIGKVDQEAVKEYASWMDIENEVVKLCPTGAIKWDGKELTIDNRECVRCM
2akjA           ----TGCPNSCGQVQVADIGFMG-----------------------------------------------
3c7bB           KISLACCANMCGAVHASDIAIVGITPPEAIRKTC-EIPSTVAACP---TGALKMKNKTIKVDVEKCMYCG
1fehA           -----------------------------DRTKCLLCGRCVNACKNTETYAMKFKNGKTIFDDTNCLLCG
2v4jA           KFKFDACPNGCVASARSDFSVIGTWKDEFKPNAGAHSGEVVNRCPSK---CMKWDGSKLSIDNKECVRCM
2fdnA           ---------------------------------CISCGACEPECP---VNAISSGDDRYVIDADTCIDCG
1clfA           ---------------------------------CVSCGACASECP---VNAISQGDSIFVIDADTCIDCG
1fcaA           ---------------------------------CISCGACEPECP---VDAISQGGSRYVIDADTCIDCG
1kqfB           K--------SWTVMRFSETEQNGKLEWLIRKDGCMHCEGCLKACPS-AGAIIQYANGIVDFQSENCIGCG
3bk7A           ----------------------------YDKCNPDKCGLCERVCPVNRMGGIDEENYKPIIQEASCTGCG
1zj8A           ----------------------------------------------------------------------
1hfeL           ---------------------------QIDEAKCIGCDTCSQYCPTAAIFGEMGEPHSIPHIEA-CINCG
7gepA           VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
3geoA           VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
2gepA           VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
1gep-           VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
1geo-           VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
1e08A           ---------------------------QIDEAKCIGCDTCSQYCPTAAIFGEMGEPHSIPHIEA-CINCG
4aopA           VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
1aopA           VMRVTGCPNGCGRAMLAEVGLVGKAPGRY-----------------------------------------
2v4jB           RISLACCINMCGAVHCSDIGVVGMIDHEWTDQLCLAVASCPTAAVRPTKLEIGDKKVNTIAKNERCMYCG
1jb0C           ---------------------------------CIGCTQCVRACPTDVLEMVPWDGCKAGQIASSCVGCK
1k0tA           ---------------------------------CIGCTQCVRACPLDVLEMVPWDGCKAGQIASSCVGCK
2o01C           ---------------------------------CIGCTQCVRACPTDVLEMIPWGGCKAKQIASACVGCK
1durA           ---------------------------------CIACGACKPECPVNCIQ----EGSIYAIDADSCIDCG
1fdx-           ---------------------------------CIACGACKPECPVNIIQGSIY-----AIDADSCIDCG


                         .         .         .         +         .         .         .:280
query           ECVMNCPTNAWTRSKEKYYRLAIMGRTGKKNPRLAEDFILWVDEDSIIKIILNTYKYVTEYIAKDAPGGK
3c7bA           HCINKMP-KALKPGDERGATILI----GGKAPFVEGAVIGWVAVPFVVEKPYDEIKEILEAIWDDEEGKR
2akjA           ----------------------------------------------------------------------
3c7bB           NCYTMCPGMPLFDPENDGAAIMVGGKEARRMPELSKVVVPWVPNEPPRWPTL--VKYVKQILEAWAANAN
1fehA           QCIIACPVAA------------------------------------------------------------
2v4jA           HCINTMP---------------------------------------------------------------
2fdnA           ACAGVCPVDA------------------------------------------------------------
1clfA           NCANVCPVGA------------------------------------------------------------
1fcaA           ACAGVCPVDA------------------------------------------------------------
1kqfB           YCIAGCPFNIPRLNKE------------------------------------------------------
3bk7A           ICVHKCPFNA------------------------------------------------------------
1zj8A           ----------------------------------------------------------------------
1hfeL           QCLTHCPENA------------------------------------------------------------
7gepA           ----------------------------------------------------------------------
3geoA           ----------------------------------------------------------------------
2gepA           ----------------------------------------------------------------------
1gep-           ----------------------------------------------------------------------
1geo-           ----------------------------------------------------------------------
1e08A           QCLTHCPENA------------------------------------------------------------
4aopA           ----------------------------------------------------------------------
1aopA           ----------------------------------------------------------------------
2v4jB           NCYTMCPALPISDGEGDGVVIMVGGKVSNRMPKFSKVVVAYINEPPRWPSLTKTIKHIIEVYSANA-YKY
1jb0C           RCETACPTD-------------------------------------------------------------
1k0tA           RCETACPTD-------------------------------------------------------------
2o01C           RCESACPTD-------------------------------------------------------------
1durA           SCASVCPVGA------------------------------------------------------------
1fdx-           SCASVCPVGA------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EHIGYIIDRTGFMEFKKWALEGVTLSxxxxxxxxxxxxxxxxxxxx
3c7bA           ERIGELIWRKGMREFLK-----------------------------
2akjA           ----------------------------------------------
3c7bB           KHERLIVDRIGWERF-------------------------------
1fehA           ----------------------------------------------
2v4jA           ----------------------------------------------
2fdnA           ----------------------------------------------
1clfA           ----------------------------------------------
1fcaA           ----------------------------------------------
1kqfB           ----------------------------------------------
3bk7A           ----------------------------------------------
1zj8A           ----------------------------------------------
1hfeL           ----------------------------------------------
7gepA           ----------------------------------------------
3geoA           ----------------------------------------------
2gepA           ----------------------------------------------
1gep-           ----------------------------------------------
1geo-           ----------------------------------------------
1e08A           ----------------------------------------------
4aopA           ----------------------------------------------
1aopA           ----------------------------------------------
2v4jB           ERLGEWAERIGWERF--FSLTGLEFS--------------------
1jb0C           ----------------------------------------------
1k0tA           ----------------------------------------------
2o01C           ----------------------------------------------
1durA           ----------------------------------------------
1fdx-           ----------------------------------------------