[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:asrB.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ep1B.bssp"
#ERROR : Can't open dsspfile "2eixA.bssp"
#ERROR : Can't open dsspfile "1umkA.bssp"
#ERROR : Can't open dsspfile "2rc5C.bssp"
#ERROR : Can't open dsspfile "1qx4A.bssp"
#ERROR : Can't open dsspfile "1i7pA.bssp"
#ERROR : Can't open dsspfile "2rc5A.bssp"
#ERROR : Can't open dsspfile "1ndhA.bssp"
#ERROR : Can't open dsspfile "1tvcA.bssp"
#ERROR : Can't open dsspfile "2rc5D.bssp"
#ERROR : Can't open dsspfile "1qfjA.bssp"
#ERROR : Can't open dsspfile "2rc5B.bssp"
#ERROR : Can't open dsspfile "1krhA.bssp"
#ERROR : Can't open dsspfile "1a8pA.bssp"
#ERROR : Can't open dsspfile "2b5oA.bssp"
#ERROR : Can't open dsspfile "2qdxA.bssp"
#ERROR : Can't open dsspfile "2bmwA.bssp"
#ERROR : Can't open dsspfile "2vyqA.bssp"
#ERROR : Can't open dsspfile "1ogiA.bssp"
#ERROR : Can't open dsspfile "1h42A.bssp"
#ERROR : Can't open dsspfile "1bqeA.bssp"
#ERROR : Can't open dsspfile "1gawB.bssp"
#ERROR : Can't open dsspfile "1gawA.bssp"
#ERROR : Can't open dsspfile "1gaqA.bssp"

## Summary of PDB Search
:263
    9e-15  30%  1ep1B  [b.43.4 - c.25.1] DIHYDROOROTATE DEHYDROGENASE B (PYRK
    3e-14  30%  2eixA  [x.x.x] NADH-CYTOCHROME B5 REDUCTASE
    4e-07  30%  1umkA  [b.43.4 - c.25.1] NADH-CYTOCHROME B5 REDUCTASE
    1e-06  28%  2rc5C  [x.x.x] FERREDOXIN-NADP REDUCTASE
    1e-06  31%  1qx4A  [b.43.4 - c.25.1] NADH-CYTOCHROME B5 REDUCTASE
    1e-06  31%  1i7pA  [b.43.4 - c.25.1] NADH-CYTOCHROME B5 REDUCTASE
    3e-06  28%  2rc5A  [x.x.x] FERREDOXIN-NADP REDUCTASE
    3e-06  30%  1ndhA  [x.x.x] CYTOCHROME B5 REDUCTASE
    5e-06  28%  1tvcA  [b.43.4 - c.25.1] METHANE MONOOXYGENASE COMPONENT C
    5e-06  28%  2rc5D  [x.x.x] FERREDOXIN-NADP REDUCTASE
    6e-06  23%  1qfjA  [b.43.4 - c.25.1] PROTEIN (FLAVIN REDUCTASE)
    8e-06  28%  2rc5B  [x.x.x] FERREDOXIN-NADP REDUCTASE
    5e-05  26%  1krhA  [d.15.4 - b.43.4 - c.25.1] BENZOATE 1,2-DIOXYGENASE REDUCTASE
    5e-05  26%  1a8pA  [x.x.x] NADPH\:FERREDOXIN OXIDOREDUCTASE
    7e-05  28%  2b5oA  [x.x.x] FERREDOXIN--NADP REDUCTASE
    9e-05  25%  2qdxA  [x.x.x] FERREDOXIN REDUCTASE
    9e-05  22%  2bmwA  [x.x.x] FERREDOXIN--NADP REDUCTASE
    4e-04  25%  2vyqA  [x.x.x] FERREDOXIN-NADP REDUCTASE
    4e-04  25%  1ogiA  [b.43.4 - c.25.1] FERREDOXIN--NADP+ REDUCTASE
    4e-04  25%  1h42A  [b.43.4 - c.25.1] FERREDOXIN--NADP+ REDUCTASE
    4e-04  25%  1bqeA  [b.43.4 - c.25.1] FERREDOXIN--NADP REDUCTASE
    0.001  23%  1gawB  [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE
    0.001  23%  1gawA  [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE
    0.001  23%  1gaqA  [b.43.4 - c.25.1] FERREDOXIN-NADP+ REDUCTASE
:263

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxNEYTPFISKILNVKKHTDIEYTFRMEFKGDVKPGQFFEVSLPKFGEAPISVSGIGEDYVELTIRRVGV
1ep1B           --------LQEMMTVVSQREVAYNFEMVLKGTLVPGQFLHLAVPNGARRPISISSWDKRAKTCTILRIGD
2eixA           --NEYKKFMLREKQIINHNTRLFRFNLHHPEDVVGGQHMSVKATVDGKTPVS-SDDEKGYFDLIIKEKGQ
1umkA           ----------------------------------------------------------------------
2rc5C           ---------------KKAKDVGYTVRL-----------YSIASPSYS------FGMKEDNIEFIIKRKGV
1qx4A           ----------------------------------------------------------------------
1i7pA           ----------------------------------------------------------------------
2rc5A           ------------------------------------------------------GMKEDNIEFIIKRKGV
1ndhA           ----------------------------------------------------------------------
1tvcA           ---------------------------------EPGQFMDLTIPSRSYSPANLPN-PEGRLEFLIR---V
2rc5D           ---------------------------------------------------SYFGMKEDNIEFIIKRKGV
1qfjA           -----TTLSCKVTSVEAITDTVYRVRIDAAFSFRAGQYLMVVMDERDKRPFSMASTPDEFIELHIGYAKA
2rc5B           ---------------KKAKDVGYTVRL-----------YSIASPSY---------MKEDNIEFIIKRKGV
1krhA           ----------------------------------------------------------------------
1a8pA           --------VERVLSVHHWNDTLFSFKTTRNPSLRNGQFVMIGLEVDGRPLMRAYSIAEEHLEFFSIKVGP
2b5oA           ----------------------------------------------------------------------
2qdxA           -------YTERVLSVHHWNDTLFSFKTTRNPGLKTGQFVMIGLEVDGRPLMRAYSIAEEHLEFFSIKVGP
2bmwA           --------------------------------------------------------------------GV
2vyqA           --------------------------------------------------------------------GV
1ogiA           --------------------------------------------------------------------GV
1h42A           --------------------------------------------------------------------GV
1bqeA           --------------------------------------------------------------------GV
1gawB           --------------------------------------------------------------------GV
1gawA           --------------------------------------------------------------------GV
1gaqA           --------------------------------------------------------------------GV


                         .         .         *         .         .         .         .:140
query           VTNEIFEKYEGDKLFLRGPYGNGFDVNNYKGKEVIVVAGGTGLSPVKGIVDYFSQNPKDAESFTLISGFK
1ep1B           ETTGTYKKLEGAKVDVMGPLGNGFPVAEVTSTDKXXXXXXXXXVPP--LYELAKQLEKTGCQMTILLGFA
2eixA           MSQYIDHLNPGDFLQVRGPKGQ-FDYKPNMVKEMGMIAGGTGITPMLQVARAIIKNPKEKTIINLIFANV
1umkA           ----------GDTIEFRGP--SGLLVYQGKGKFAIMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQ
2rc5C           CSNYMCDLKPGDEVTMTGPSGKKFLLPNFSG-DIMFLATGTGIAPFIGMSEELLEHKKFTGNITLVYGAP
1qx4A           ----------GDTIEFRGP--NGLLVYQGKGKFAIMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQ
1i7pA           ----------GDTIEFRGP--NGLLVYQGKGKFAIMIAGGTGITPMLQVIRAVLKDPNDHTVCYLLFANQ
2rc5A           CSNYMCDLKPGDEVTMTGPSGKKFLLPNFSG-DIMFLATGTGIAPFIGMSEELLEHKKFTGNITLVYGAP
1ndhA           ----------GDTIEFRGP--NGLLVYQGKGKFAIMIAGGTGITPMLQVIRAIMKDPDDHTVCHLLFANQ
1tvcA           LPEGRFSDYVGQVLSVKGPLGV-FGLKERGMAPRYFVAGGTGLAPVVSMVRQMQEWTAPNET-RIYFGVN
2rc5D           CSNYMCDLKPGDEVTMTGPSGKKFLLPNFSG-DIMFLATGTGIAPFIGMSEELLEHKKFTGNITLVYGAP
1qfjA           VMDRILKDHQ---IVVDIPHGEAW-LRDDEERPMILIAGGTGFSYARSILTALARNPN--RDITIYWGGR
2rc5B           CSNYMCDLKPGDEVTMTGPSGKKFLLPNFSG-DIMFLATGTGIAPFIGMSEELLEHKKFTGNITLVYGAP
1krhA           ----------GDKMSFTGPFGS-FYLRDVK-RPVLMLAGGTGIAPFLSMLQVLEQKGSE-HPVRLVFGVT
1a8pA           LTSRLQHLKEGDELMVRKPTGTLVTSDLLPGKHLYMLSTGTGLAPFMSLI----QDPEVYERFVLIHGVR
2b5oA           -----------DDVKITGPVGKEMLLPDDEDATVVMLATGTGIAPFRAFLRMFKEQHEDYKKAWLIFGVP
2qdxA           LTSRLQHLKEGDELMVRKPTGTLVHDDLLPGKHLYLLSTGTGMAPFLSVI----QDPETYERYILVHGVR
2bmwA           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMR---TYLWRMFKDAERAALVFGVP
2vyqA           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMR---TYLWRMFKDAERAALVFGVP
1ogiA           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMR---TYLWRMFKDAERAALVFGVP
1h42A           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMR---TYLWRMFKDAERAALVFGVP
1bqeA           CSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGIAPMR---TYLWRMFKDAERAALVFGVP
1gawB           CSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNLFLGVP
1gawA           CSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNLFLGVP
1gaqA           CSNFLCDLQPGDNVQITGPVGKEMLMPKDPNATIIMLATGTGIAPFRSFLWKMFFEKHDDYKFNLFLGVP


                         +         .         .         .         .         *         .:210
query           GPKDILFKDDMKEWEKNMNMIITVDSAEEGYEGNTGLVTKYIPELEIKDMDNVQVIVVGPPMMMKFTVLE
1ep1B           SENVKILENEFSNL-KNVTLKIATDDGSYGTKGHVGMLMNEI------DFEVDALYTCGAPAMLKAVA--
2eixA           NEDDILLRDDMAKKYSNFKVYYVLNNPPAGWTGGVGFVSDMIKQHFSPPSSDIKVMMCGPPMMNK-----
1umkA           TEKDILLRPELEELRNRFKLWYTLDRAPEAWDYGQGFVNEMIRDHLXXXXXXXLVLMCGPPPMIQYACL-
2rc5C           YSDELVMMDYLKGLEKNFKLITAISREEKSFDGGRMYISHRVRE--------------------------
1qx4A           SEKDIXXXXXXXXXSSRFKLWYTVDKAPDAWDYSQG----FVNEEMIRDHEETLILMCGPPPMIQFACLP
1i7pA           SEKDIXXXXXXXXXSSRFKLWYTVDKAPDAWDYSQG----FVNEEMIRDHEETLILMCGPPPMIQFACLP
2rc5A           YSDELVMMDYLKGLEKNFKLITAISREEKSFDGGRMYISHRVRE--------------------------
1ndhA           TEKDIXXXXXXXXXSARFKLWYTVDRAPEAWDYSQGFVNEMIRDHLXXXXXXXLVLMCGPPPMIQYACLP
1tvcA           TEPELFYIDELKSLERSMRNLTVVWHPSGDWEGEQGSPIDALRELESSDA-NPDIYLCGPPGMIDAACEL
2rc5D           YSDELVMMDYLKGLEKNFKLITAISREEKSFDGGRMYISHRVRE--------------------------
1qfjA           EEQDLCELEALSLKHPGLQVVPVVEQPEAGWRGRTGTV--------------------------------
2rc5B           YSDELVMMDYLKGLEKNFKLITAISREEKSFDGGRMYISHRVRE--------------------------
1krhA           QDCDLVALEQLDALQQKLPWFRTVVAHAESQHERKGYVTGHI-EYDWLNGGEVDVYLCGPVPMVEAVRSW
1a8pA           QVNELAYQQFITE---------------------------------------------------------
2b5oA           YTANILYKDDFEENPDNFRLTYAISREQKTADGGQSRVSEYADELEMIQKPNTHVYMCGPPIDETFTAWE
2qdxA           WVSELAYAD-------------------------------------------------------------
2bmwA           TTPNILYKEELEEYPDNFRLTYAISREQKNPQGGRMYIQDRVAEWQLIKNQKTHTYICGPPPMEEGIDAA
2vyqA           TTPNILYKEELEEYPDNFRLTYAISREQKNPQGGRMYIQDRVAE--------------------------
1ogiA           TTPNILYKEELEEYPDNFRLTYAISREQKNPQGGRMYIQDRVAE--------------------------
1h42A           TTPNILYKEELEEYPDNFRLTYAISREQKNPQGGRMYIQDRVAE--------------------------
1bqeA           TTPNILYKEELEEYPDNFRLTYAISREQKNPQGGRMYIQDRVAE--------------------------
1gawB           TSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYI----------------------------
1gawA           TSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYI----------------------------
1gaqA           TSSSLLYKEEFGKMKERAPENFRVDYAVSREQTNAAGERMYI----------------------------


                         .         .         .         +         .         .         .:280
query           FLKRGIKEENIWISQERKMCCGLGKCGHCKIDDTYICLDGPVFxxxxxxxxxx
1ep1B           --KKYDQLERLYISMESRMACGIGACYACKEDESHVCEDGPVF----------
2eixA           -----------------------------------------------------
1umkA           -----------------------------------------------------
2rc5C           -----------------------------------------------------
1qx4A           NLER-------------------------------------------------
1i7pA           NLER-------------------------------------------------
2rc5A           -----------------------------------------------------
1ndhA           NLER-------------------------------------------------
1tvcA           VRSRGIPGEQVFFEK--------------------------------------
2rc5D           -----------------------------------------------------
1qfjA           -----------------------------------------------------
2rc5B           -----------------------------------------------------
1krhA           LDTQGIQPAN-------------------------------------------
1a8pA           -----------------------------------------------------
2b5oA           EMRRSMKKEHRW-----------------------------------------
2qdxA           -----------------------------------------------------
2bmwA           LSAAAAKEGVTWSDYQKDL----------------------------------
2vyqA           -----------------------------------------------------
1ogiA           -----------------------------------------------------
1h42A           -----------------------------------------------------
1bqeA           -----------------------------------------------------
1gawB           -----------------------------------------------------
1gawA           -----------------------------------------------------
1gaqA           -----------------------------------------------------