[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE1487

[Show Plain Result]

#ERROR : Can't open dsspfile "3hn0B.bssp"
#ERROR : Can't open dsspfile "3hn0A.bssp"

## Summary of PDB Search
:334
    2e-22  31%  3hn0B  [x.x.x] NITRATE TRANSPORT PROTEIN
    2e-22  31%  3hn0A  [x.x.x] NITRATE TRANSPORT PROTEIN
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTSIEIVVPDGLPAISIVKMIKEKPEIMKGLDI
3hn0B           --------------------------------------TVIKVSVLRGPSVIAFADWL-ENPPIIDNKKV
3hn0A           --------------------------------------TVIKVSVLRGPSVIAFADWL-ENPPIIDNKKV


                         .         .         *         .         .         .         .:140
query           NYSIVKGSDALVSKVLKGEGDICIVPSNVAAIAYNKEAKYKLAGTVGFGSLYVISSDDSVNSLEDLKGKD
3hn0B           QVKVVDSPDLAQALLIKQETDIAVLPINAANL-YNKGIKIKLAGCPIWGTLYLVEKTP-------LKEPA
3hn0A           QVKVVDSPDLAQALLIKQETDIAVLPINAANL-YNKGIKIKLAGCPIWGTLYLVEKTP-------LKEPA


                         +         .         .         .         .         *         .:210
query           VYNVGQGLTPDLIFKILLQNDGINPEKDLTLSYVNAASELAPLFIEGKAKYAVVPEPMLTQIMTKKPETK
3hn0B           LYVFGNGTTPDILTRYYLGRQRL----DYPLNYANTAGEITQGILAGKVNRAVLGEPFLSIALRKDSSLR
3hn0A           LYVFGNGTTPDILTRYYLGRQRL----DYPLNYANTAGEITQGILAGKVNRAVLGEPFLSIALRKDSSLR


                         .         .         .         +         .         .         .:280
query           IVASLNEQWKEMSDSKMGYPQSSVIVKEDLAKNNSEAVQKILKEIDNSTKWANENKEEAGAFAEEVGITG
3hn0B           ITADLNHL---TDNDTLGFAQTAVVYTP--TEKYRIAFEDALRA---SCQKAVRYPKETIHSLEEHGIFA
3hn0A           ITADLNHL---TDNDTLGFAQTAVVYTP--TEKYRIAFEDALRA---SCQKAVRYPKETIHSLEEHGIFA


                         .         *         .         .         .         .         +:350
query           KKEIIAKSLERANLNYVSALDSESEYIKYYDKIYSLEPKAIGGKxxxxxxxxxx
3hn0B           QGALTPKSIERCKIYYLSAIEAK-DAVGFLRLIEQYEPKAVGGR----------
3hn0A           QGALTPKSIERCKIYYLSAIEAK-DAVGFLRLIEQYEPKAVGGR----------