[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:nifU

[Show Plain Result]

#ERROR : Can't open dsspfile "2z7eC.bssp"
#ERROR : Can't open dsspfile "2z7eB.bssp"
#ERROR : Can't open dsspfile "2z7eA.bssp"
#ERROR : Can't open dsspfile "1q48A.bssp"
#ERROR : Can't open dsspfile "1wfzA.bssp"
#ERROR : Can't open dsspfile "1xjsA.bssp"
#ERROR : Can't open dsspfile "2qq4I.bssp"
#ERROR : Can't open dsspfile "2qq4F.bssp"
#ERROR : Can't open dsspfile "2qq4B.bssp"
#ERROR : Can't open dsspfile "2qq4A.bssp"
#ERROR : Can't open dsspfile "1su0B.bssp"

## Summary of PDB Search
:142
    1e-37  55%  2z7eC  [x.x.x] NIFU-LIKE PROTEIN
    1e-37  55%  2z7eB  [x.x.x] NIFU-LIKE PROTEIN
    1e-37  55%  2z7eA  [x.x.x] NIFU-LIKE PROTEIN
    2e-34  55%  1q48A  [d.224.1] NIFU-LIKE PROTEIN
    1e-28  54%  1wfzA  [d.224.1] NITROGEN FIXATION CLUSTER-LIKE
    3e-20  42%  1xjsA  [d.224.1] NIFU-LIKE PROTEIN
    1e-18  36%  2qq4I  [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
    1e-18  36%  2qq4F  [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
    1e-18  36%  2qq4B  [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
    1e-18  36%  2qq4A  [x.x.x] IRON-SULFUR CLUSTER BIOSYNTHESIS PROTEIN ISCU
    9e-14  36%  1su0B  [d.224.1] NIFU LIKE PROTEIN ISCU
:142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIYSEKVMDHFKNPRNVGEIKDANGIGEVGNAKCGDIMRIYLKIENNIVEDVKFETYGCGSAIASSSMAT
2z7eC           --YNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGAAMLFTIKVENDVIEDVRFKTFGCGSAIAVSSMLT
2z7eB           --YNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGAAMLFTIKVENDVIEDVRFKTFGCGSAIAVSSMLT
2z7eA           --YNEKVLDHFLNPRNVGVLEDANGVGQCGNPACGAAMLFTIKVENDVIEDVRFKTFGCGSAIAVSSMLT
1q48A           MAYSEKVIDHYENPRNVGSLKDSNGTGMVGAPACGDVMQLQIKVDDNIIEDAKFKTYGCGSAIASSSLIT
1wfzA           -----------ENPRNVGSLDKTSGTGLVGAPACGDVMKLQIQVEKGKIVDARFKTFGCGSAIASSSLAT
1xjsA           -LYRQVIMDHYKNPRNKGVLNDSIVV-DMNNPTCGDRIRLTMKLDGDIVEDAKFEGEGCSISMASASMMT
2qq4I           -LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAISTASASLMT
2qq4F           -LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAISTASASLMT
2qq4B           -LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAISTASASLMT
2qq4A           -LYREILLDHYQSPRNFGVLPQATKQAGGMNPSCGDQVEVMVLLEGDTIADIRFQGQGCAISTASASLMT
1su0B           -LYMAVVADHSKRPHHHGQLDGVEAV-QLNNPTCGDVISLTVKFDEDKIEDIAFAGNGCTISTASSSMMT


                         .         .         *         .         .         .         .:140
query           ELIKGKTVEEAWELSNKAVAEALDGLPPVKMHCSVLAEEAIHKAINDYRQRQGLEPWDMKEHSHDIHxxx
2z7eC           EMVKGKPIQYALNLTYKDIFEELGGLPPQKIHCTNLGLETLHVAIKDYLMKQG-----------------
2z7eB           EMVKGKPIQYALNLTYKDIFEELGGLPPQKIHCTNLGLETLHVAIKDYLMKQG-----------------
2z7eA           EMVKGKPIQYALNLTYKDIFEELGGLPPQKIHCTNLGLETLHVAIKDYLMKQG-----------------
1q48A           EWVKGKSLEEAGAIKNSQIAEELE-LPPVKVHCSILXXXXXXXXXXXXXXXQGL------EHHHHHH---
1wfzA           EWVKGKTVEEALTIKNTDIAKEL-CLPPVKLHCSMLAEDAIKAALADYKLKQ------------------
1xjsA           QAIKGKDIETALSMSDLGDIEALQGVSPARIKCATLSWKALEKGV-------------------------
2qq4I           EAVKGKKVAEALELSRKFQAMVVEGAPPDPTLGDLLALQGVAK---------------------------
2qq4F           EAVKGKKVAEALELSRKFQAMVVEGAPPDPTLGDLLALQGVAK---------------------------
2qq4B           EAVKGKKVAEALELSRKFQAMVVEGAPPDPTLGDLLALQGVAK---------------------------
2qq4A           EAVKGKKVAEALELSRKFQAMVVEGAPPDPTLGDLLALQGVAK---------------------------
1su0B           DAVIGKSKEEALALADLGEAELLAGVAPQRIKCSTLAWNALKEAI-------------------------


                         +         .         .         .         .         *         .:210
query           xx
2z7eC           --
2z7eB           --
2z7eA           --
1q48A           --
1wfzA           --
1xjsA           --
2qq4I           --
2qq4F           --
2qq4B           --
2qq4A           --
1su0B           --