[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE1854

[Show Plain Result]

#ERROR : Can't open dsspfile "1w8gA.bssp"
#ERROR : Can't open dsspfile "1b54A.bssp"
#ERROR : Can't open dsspfile "1ct5A.bssp"
#ERROR : Can't open dsspfile "3cpgA.bssp"

## Summary of PDB Search
:219
    7e-24  39%  1w8gA  [x.x.x] HYPOTHETICAL UPF0001 PROTEIN YGGS
    3e-20  35%  1b54A  [x.x.x] YEAST HYPOTHETICAL PROTEIN
    1e-16  35%  1ct5A  [c.1.6] PROTEIN (YEAST HYPOTHETICAL PROTEIN, SELENOMET)
    3e-13  31%  3cpgA  [x.x.x] UNCHARACTERIZED PROTEIN
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xDIKENLTKFTEKIPSNVQLIAVSKTRTIEEMEEAYEFGIRKFGENKVQEIIRKFDEFHQDVEWHLIGHL
1w8gA           -DIAHNLAQVRDKIPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQEGLEWHFIGPL
1b54A           ------------------------------DIQILYDHGVREFGENYVQELIEKAKLLPDDIKWHFIGGL
1ct5A           ------------------------------DIQILYDHGVREFGENYVQELIEKAKLLPDDIKWHFIGGL
3cpgA           ----------------SVRLLAATKTRDIGEIA-AIDAGVR-IGENRPQEVTAKAEGLAEHIPFHLIGQL


                         .         .         *         .         .         .         .:140
query           QTNKVKYIVDKVHLIQSLDSIKLLKEIEKVYGKHNKIANTLIQVNIGREEQKYGXXXXXXXXXXXXXXXC
1w8gA           QSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQXXXXXXXXXXXXXX
1b54A           QTNKCKDLVPNLYSVETIDSLKKAKKLNESRAKFQPDCNPIVQINTSHEDQKSGEAEIFEVIDFFLSEEC
1ct5A           QTNKCKDLVPNLYSVETIDSLKKAKKLNESRAKFQPDCNPIVQINTSHEDQKSGLN--------------
3cpgA           QSNKIGKVLPVVDTIESVDSIDLAEKISRRAVARGITVGVLLEVNESGEESKSGCDPAHAIRIAQKIGTL


                         +         .         .         .         .         *         .:210
query           NNVNVLGIMTIIPKGTEEECRKYFSKTHXXXXXXXXXXXXNIKMDILSMGMSGDYEIATEEGSNMVRIGQ
1w8gA           PRLRLRGLMAI--PAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGT
1b54A           KYIKLNGLMTI---GSWE--NRDFATLVEWKKKIDAKFGTSLK---LSMGMSADFREAIRQGTAEVRIGT
1ct5A           ---NEAEIFEVIDFFLSEECK--YIKLNGLTIGSWNRDFATLKIDALKLSGSADFREAIRQGTAEVRIGT
3cpgA           DGIELQGLTIGAHVHDETVIRRGFSKTRDLILASGEPGTDRCR----ELSGTGD-ELAIAEGSTIVRVGT


                         .         .         .         +         .         .         .:280
query           GIFGxxxxx
1w8gA           AIFG-----
1b54A           DIFG-----
1ct5A           DIFG-----
3cpgA           AIF------