[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE1920

[Show Plain Result]

#ERROR : Can't open dsspfile "1na0A.bssp"
#ERROR : Can't open dsspfile "2fo7A.bssp"
#ERROR : Can't open dsspfile "1na3A.bssp"
#ERROR : Can't open dsspfile "2avpA.bssp"
#ERROR : Can't open dsspfile "3fp4A.bssp"
#ERROR : Can't open dsspfile "2gw1A.bssp"
#ERROR : Can't open dsspfile "3fp2A.bssp"
#ERROR : Can't open dsspfile "2c2lA.bssp"
#ERROR : Can't open dsspfile "3fp3A.bssp"
#ERROR : Can't open dsspfile "3fwvA.bssp"
#ERROR : Can't open dsspfile "2vyiB.bssp"
#ERROR : Can't open dsspfile "2vyiA.bssp"
#ERROR : Can't open dsspfile "2q7fA.bssp"
#ERROR : Can't open dsspfile "2bugA.bssp"
#ERROR : Can't open dsspfile "1elrA.bssp"
#ERROR : Can't open dsspfile "1wao4.bssp"
#ERROR : Can't open dsspfile "1wao2.bssp"
#ERROR : Can't open dsspfile "1wao1.bssp"
#ERROR : Can't open dsspfile "1a17A.bssp"
#ERROR : Can't open dsspfile "2dbaA.bssp"
#ERROR : Can't open dsspfile "1elwB.bssp"
#ERROR : Can't open dsspfile "1elwA.bssp"
#ERROR : Can't open dsspfile "2j9qB.bssp"
#ERROR : Can't open dsspfile "2j9qA.bssp"
#ERROR : Can't open dsspfile "2c0mC.bssp"
#ERROR : Can't open dsspfile "2c0mA.bssp"
#ERROR : Can't open dsspfile "2c0lA.bssp"
#ERROR : Can't open dsspfile "1qz2A.bssp"
#ERROR : Can't open dsspfile "1p5qA.bssp"
#ERROR : Can't open dsspfile "1kt1A.bssp"
#ERROR : Can't open dsspfile "1kt0A.bssp"
#ERROR : Can't open dsspfile "1fchB.bssp"
#ERROR : Can't open dsspfile "1fchA.bssp"
#ERROR : Can't open dsspfile "2fbnB.bssp"
#ERROR : Can't open dsspfile "2fbnA.bssp"
#ERROR : Can't open dsspfile "3cvqA.bssp"
#ERROR : Can't open dsspfile "3cvpA.bssp"
#ERROR : Can't open dsspfile "3cvnA.bssp"
#ERROR : Can't open dsspfile "3cvlA.bssp"
#ERROR : Can't open dsspfile "3cv0A.bssp"
#ERROR : Can't open dsspfile "2vkoC.bssp"
#ERROR : Can't open dsspfile "2vkoB.bssp"
#ERROR : Can't open dsspfile "2vkoA.bssp"
#ERROR : Can't open dsspfile "2vkjA.bssp"
#ERROR : Can't open dsspfile "2kckA.bssp"

## Summary of PDB Search
:116
    2e-13  36%  1na0A  [k.38.1] DESIGNED PROTEIN CTPR3
    2e-13  36%  2fo7A  [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN
    1e-10  43%  1na3A  [k.38.1] DESIGNED PROTEIN CTPR2
    1e-10  43%  2avpA  [x.x.x] SYNTHETIC CONSENSUS TPR PROTEIN
    2e-10  35%  3fp4A  [x.x.x] TPR REPEAT-CONTAINING PROTEIN YHR117W
    9e-10  43%  2gw1A  [x.x.x] MITOCHONDRIAL PRECURSOR PROTEINS IMPORT RECEPTOR
    1e-08  35%  3fp2A  [x.x.x] TPR REPEAT-CONTAINING PROTEIN YHR117W
    5e-08  31%  2c2lA  [x.x.x] CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
    1e-07  36%  3fp3A  [x.x.x] TPR REPEAT-CONTAINING PROTEIN YHR117W
    4e-07  27%  3fwvA  [x.x.x] HSC70/HSP90-ORGANIZING PROTEIN
    5e-07  26%  2vyiB  [x.x.x] SGTA PROTEIN
    5e-07  26%  2vyiA  [x.x.x] SGTA PROTEIN
    5e-07  27%  2q7fA  [x.x.x] YRRB PROTEIN
    4e-06  29%  2bugA  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    6e-06  26%  1elrA  [a.118.8] TPR2A-DOMAIN OF HOP
    8e-06  29%  1wao4  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    8e-06  29%  1wao2  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    8e-06  29%  1wao1  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    8e-06  29%  1a17A  [x.x.x] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    2e-05  35%  2dbaA  [x.x.x] SMOOTH MUSCLE CELL ASSOCIATED PROTEIN-1, ISOFORM
    3e-05  29%  1elwB  [a.118.8] TPR1-DOMAIN OF HOP
    3e-05  29%  1elwA  [a.118.8] TPR1-DOMAIN OF HOP
    2e-04  29%  2j9qB  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    2e-04  29%  2j9qA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    2e-04  29%  2c0mC  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    2e-04  29%  2c0mA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    2e-04  29%  2c0lA  [x.x.x] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    3e-04  36%  1qz2A  [d.26.1 - a.118.8] FK506-BINDING PROTEIN 4
    3e-04  36%  1p5qA  [d.26.1 - a.118.8] FK506-BINDING PROTEIN 4
    3e-04  46%  1kt1A  [d.26.1 - d.26.1 - a.118.8] FK506-BINDING PROTEIN FKBP51
    3e-04  46%  1kt0A  [d.26.1 - d.26.1 - a.118.8] 51 KDA FK506-BINDING PROTEIN
    4e-04  30%  1fchB  [a.118.8] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    4e-04  30%  1fchA  [a.118.8] PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
    5e-04  27%  2fbnB  [x.x.x] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE
    5e-04  27%  2fbnA  [x.x.x] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE
    7e-04  29%  3cvqA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    7e-04  29%  3cvpA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    7e-04  29%  3cvnA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR
    7e-04  29%  3cvlA  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    7e-04  29%  3cv0A  [x.x.x] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    0.001  37%  2vkoC  [x.x.x] TM1634
    0.001  37%  2vkoB  [x.x.x] TM1634
    0.001  37%  2vkoA  [x.x.x] TM1634
    0.001  37%  2vkjA  [x.x.x] TM1634
    0.001  23%  2kckA  [x.x.x] TPR REPEAT
:116

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSNFSKGNELYNTRNYSDAINYYKKALDNDECKCHSYYNAGVCYIKLKQYEKAIEMITKALELYQDSKYF
1na0A           ---YNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALELPNNAEAW
2fo7A           ---YNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELPRSAEAW
1na3A           ---YNLGNAYYKQGDYDEAIEYYQKALELDPNNAEAWYNLGNAYYKQGDYDEAIEYYQKALEL-------
2avpA           ---YNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALEL-------
3fp4A           ----NRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDSKAL
2gw1A           -----KGNQFFRNKKYDDAIKYYNWALELKEDPVF-YSNLSACYVSVGDLKKVVEMSTKALELKPD----
3fp2A           ----NRGNHFFTAKNFN-AIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDSKAL
2c2lA           -----QGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELGQSVKAH
3fp3A           --------------HFFTAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDSKAL
3fwvA           ------GNDAYKKKDFDTALKHYDKAKELDPTNMTYIVNQAAVYFEKGDYNKCRELCEKAIEVGRENRED
2vyiB           ----TEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPASKAY
2vyiA           ----TEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPASKAY
2q7fA           -------NLLSSVNELERALAFYDKALELDSSAATAYYGAGNVYVVKEMYKEAKDMFEKALRAMENGDLF
2bugA           ----TQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALNDATRAIEL--DKKY-
1elrA           ------GNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREY
1wao4           ----TQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIEL--DKKY-
1wao2           ----TQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIEL--DKKY-
1wao1           ----TQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIEL--DKKY-
1a17A           ----TQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDATRAIEL--DKKY-
2dbaA           -----EGNELFKCGDYGGALAAYTQALGLDQDQAVLHRNRAACHLKLEDYDKAETEASKAIE--------
1elwB           -----KGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDGKGY
1elwA           -----KGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDGKGY
2j9qB           ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSR--
2j9qA           ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSR--
2c0mC           ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSR--
2c0mA           ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSR--
2c0lA           ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSR--
1qz2A           -----RGTVYFKEGKYKQALLQYKKSFSNEEARLASHLNLAMCHLKLQAFSAAIESCNKALEL-------
1p5qA           -----RGTVYFKEGKYKQALLQYKKSFSNEEARLASHLNLAMCHLKLQAFSAAIESCNKALEL-------
1kt1A           -----------------------------------AFLNLAMCYLKLREYTKAVECCDKALGL-------
1kt0A           -----------------------------------AFLNLAMCYLKLREYTKAVECCDKALGL-------
1fchB           ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKS---
1fchA           ------GATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKS---
2fbnB           -----------HTEEWDDQILLDKKK--NIEISCN--LNLATCYNKNKDYPKAIDHASKVLKIDKNNKAL
2fbnA           -----------HTEEWDDQILLDKKK--NIEISCN--LNLATCYNKNKDYPKAIDHASKVLKIDKNNKAL
3cvqA           ------GATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAI---------
3cvpA           ------GATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAI---------
3cvnA           ------GATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAI---------
3cvlA           ------GATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAI---------
3cv0A           ------GATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAI---------
2vkoC           -SLIAEGKDLFETANYGEALVFFEKALDNEEIKKIASFYLEECRKKL-----------------------
2vkoB           -SLIAEGKDLFETANYGEALVFFEKALDNEEIKKIASFYLEECRKKL-----------------------
2vkoA           -SLIAEGKDLFETANYGEALVFFEKALDNEEIKKIASFYLEECRKKL-----------------------
2vkjA           -SLIAEGKDLFETANYGEALVFFEKALDNEEIKKIASFYLEECRKKL-----------------------
2kckA           ----------YDAGNYTESIDLFEKAIQLDPEESKYWLMKGKALYNLERYEEAVDCYNYVINVIED----


                         .         .         *         .         .         .         .:140
query           FNLAYCYSMINNNSKALRYFNLAWALDNADIDCEKAISLILSKISK
1na0A           YNLGNAYYKQGDYDEAIEYYQKALELD-------------------
2fo7A           YNLGNAYYKQGDYDEAIEYYQKALELD-------------------
1na3A           ----------------------------------------------
2avpA           ----------------------------------------------
3fp4A           LRRASANESLGNFTDAM-----------------------------
2gw1A           ----------------------------------------------
3fp2A           LRRASANESLGNFTDAM-----------------------------
2c2lA           FFLGQCQLEMESYDEAIANLQRAYSL--------------------
3fp3A           LRRASANESLGNFTDAM--FDLSVLSLNGDFD--------------
3fwvA           YRIAYAYARIGNS---------------------------------
2vyiB           GRMGLALSSLNKHVEAVAYYKKALELD-------------------
2vyiA           GRMGLALSSLNKHVEAVAYYKKALELD-------------------
2q7fA           YMLGTVLVKLEQPKLALPYLQRAVELNENDTEARFQFGMCLA----
2bugA           ----------------------------------------------
1elrA           RQIAKAYARIGNS---------------------------------
1wao4           ----------------------------------------------
1wao2           ----------------------------------------------
1wao1           ----------------------------------------------
1a17A           ----------------------------------------------
2dbaA           ----------------------------------------------
1elwB           SRKAAALEFLNRFEEAKRTY--------------------------
1elwA           SRKAAALEFLNRFEEAKRTY--------------------------
2j9qB           ----------------------------------------------
2j9qA           ----------------------------------------------
2c0mC           ----------------------------------------------
2c0mA           ----------------------------------------------
2c0lA           ----------------------------------------------
1qz2A           ----------------------------------------------
1p5qA           ----------------------------------------------
1kt1A           ----------------------------------------------
1kt0A           ----------------------------------------------
1fchB           ----------------------------------------------
1fchA           ----------------------------------------------
2fbnB           YKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNKLKE
2fbnA           YKLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELCVNKLKE
3cvqA           ----------------------------------------------
3cvpA           ----------------------------------------------
3cvnA           ----------------------------------------------
3cvlA           ----------------------------------------------
3cv0A           ----------------------------------------------
2vkoC           ----------------------------------------------
2vkoB           ----------------------------------------------
2vkoA           ----------------------------------------------
2vkjA           ----------------------------------------------
2kckA           ----------------------------------------------