[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE1926

[Show Plain Result]

#ERROR : Can't open dsspfile "3dgeA.bssp"
#ERROR : Can't open dsspfile "2c2aA.bssp"
#ERROR : Can't open dsspfile "3d36B.bssp"
#ERROR : Can't open dsspfile "3d36A.bssp"
#ERROR : Can't open dsspfile "1bxdA.bssp"
#ERROR : Can't open dsspfile "1r62A.bssp"

## Summary of PDB Search
:507
    2e-21  33%  3dgeA  [x.x.x] SENSOR PROTEIN
    1e-19  34%  2c2aA  [x.x.x] SENSOR HISTIDINE KINASE
    5e-08  21%  3d36B  [x.x.x] SPORULATION KINASE B
    5e-08  21%  3d36A  [x.x.x] SPORULATION KINASE B
    6e-05  30%  1bxdA  [d.122.1] PROTEIN (OSMOLARITY SENSOR PROTEIN (ENVZ))
    2e-04  28%  1r62A  [d.122.1] NITROGEN REGULATION PROTEIN NR(II)
:507

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3dgeA           ----------------------------------------------------------------------
2c2aA           ----------------------------------------------------------------------
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
1bxdA           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFIA
3dgeA           -------------------------------------------------------------------FIA
2c2aA           -------------------------------------------------------------------FIA
3d36B           ---------------------------------------------------------------------A
3d36A           ---------------------------------------------------------------------A
1bxdA           ----------------------------------------------------------------------
1r62A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GASHELKTPIGIISGYAEGIKDGIVDHKDQGVYLDIIIDEAEKMNKLVMDMLELSKLEAGKIDLHIIDFS
3dgeA           NISHELRTPLTAIKAYAETIYNGELDLSTLKEFLEVIIDQSNHXXXXXXXXXDFSRLERKSLQINREKVD
2c2aA           NISHELRTPLTAIKAYAETIYNGELDLSTLKEFLEVIIDQSNHXXXXXXXXXDFSRLERKSLQINREKVD
3d36B           SISHEIRNPLTAARGFIQLIEEQPLAADKRRQYARIAIEELDRAEAIITDYLTFAKPAPETPE-------
3d36A           SISHEIRNPLTAARGFIQLIEEQPLAADKRRQYARIAIEELDRAEAIITDYLTFAKPAPETPE-------
1bxdA           ----------------------------------------------------------------------
1r62A           ---------------------------------------------------------------------S


                         .         .         .         .         *         .         .:420
query           LTELTEEVLVKNSVDINKNNLTVIKNYSPNEDLYVQGDDFKIEQVLTNFVTNAIKYSEPNNQIIIDIKPV
3dgeA           LCDLVESAVIKEFASSHNVNVLFESNVPCPVEAYI--DPTRIRQVLLNLLNNGVKYSKKDAKVILDEK--
2c2aA           LCDLVESAVIKEFASSHNVNVLFESNVPCPVEAYI--DPTRIRQVLLNLLNNGVKYSKKDAKVILDEK--
3d36B           --KLNVKLEIERVIDILRANMSCVDIQATLAPFSVIGEREKFRQCLLNVMKNAIE-AMPNGGTLQVYVSI
3d36A           --KLNVKLEIERVIDILRANMSCVDIQATLAPFSVIGEREKFRQCLLNVMKNAIE-AMPNGGTLQVYVSI
1bxdA           ----------------------------------------------------------------------
1r62A           IHKVAERVVTLVSMEL-PDNVRLIRDYDPSLPELAHDPD-QIEQVLLNIVRNALQALGPGGEIILRTRTA


                         .         .         +         .         .         .         .:490
query           EEDKIYFSIENTGAHIPDSDINKIWTQFYRGDTSRNRGSRSTGLGLSIVKNLLQAHESEFGVMNTENGVK
3dgeA           -DGGVLIIVEDNGIGIPDHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHESEVG-----KGSR
2c2aA           -DGGVLIIVEDNGIGIPDHAKDRIFEQFYRVD---------TGLGLAITKEIVELHESEVG-----KGSR
3d36B           DNGRVLIRIADTGVGMTKEQLERLGEPYF-----TTKGVKGTGLGMMVVYRIIES---------------
3d36A           DNGRVLIRIADTGVGMTKEQLERLGEPYF-----TTKGVKGTGLGMMVVYRIIES---------------
1bxdA           EPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISG--TGLGLAIVQRIVDNHNGMLELGTSERG--
1r62A           FQLTLHGERYRLAARIDVED-----------------NGPGIGLGLSIARNLIDQHSGKIEFTSWPGHTE


                         *         .         .         .         .         +         .:560
query           FYFTLKKSKxxxxxxxx
3dgeA           FFVWIPKDR--------
2c2aA           FFVWIPKDR--------
3d36B           -----------------
3d36A           -----------------
1bxdA           -----------------
1r62A           FYLPIRK----------