[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE2025

[Show Plain Result]

#ERROR : Can't open dsspfile "2qgqA.bssp"
#ERROR : Can't open dsspfile "2qgqC.bssp"
#ERROR : Can't open dsspfile "2qgqB.bssp"

## Summary of PDB Search
:434
    9e-18  33%  2qgqA  [x.x.x] PROTEIN TM_1862
    7e-17  30%  2qgqC  [x.x.x] PROTEIN TM_1862
    1e-16  32%  2qgqB  [x.x.x] PROTEIN TM_1862
:434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2qgqA           ----------------------------------------------------------------------
2qgqC           ----------------------------------------------------------------------
2qgqB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2qgqA           ----------------------------------------------------------------------
2qgqC           ----------------------------------------------------------------------
2qgqB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxAFLKIQDGCNRFCAYCLIPYTRGSVCSKDPKKVLDEIRSLAEHGFKEIILSGIHTASYGVDLDEKVT
2qgqA           ---AYVKISDGC-------------GSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQA
2qgqC           -----------------YAYVKISDGSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQA
2qgqB           ---AYVKISDG--------------GSLRSRSIEDITREVEDLLKEGKKEIILVAQDTTSYGIDLYRKQA


                         .         .         .         +         .         .         .:280
query           LVDLLEEIEKIDGIERVRIGSIDPTFFTEDVVRRILALKKLCPHFHLSLQSGCDATLKRMNRRYTAKEYE
2qgqA           LPDLLRRLNSLNGEFWIRV-YLHPDHLTEEII-SALELDKVVKYFDVPVQHGSDKILKL--GRTXXXXXX
2qgqC           LPDLLRRLNSLNGEFWIRV-YLHPDHLTEEII-SALELDKVVKYFDVPVQHGSDKILKL--GRTXXXXXX
2qgqB           LPDLLRRLNSLNGEFWIRV-YLHPDHLTEEII-SALELDKVVKYFDVPVQHGSDKILKL--GRTXXXXXX


                         .         *         .         .         .         .         +:350
query           DIVNLLRDKIEDVSITTDVIVGFPGXXXXXXXXXXXXLKRIALSKTHIFKYSPRxxxxxxxxxxxxxxxx
2qgqA           XXXXXIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDK----------------
2qgqC           XXXXXIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDK----------------
2qgqB           XXXXXIRERFPDAVLRTSIIVGFPGETEEDFEELKQFVEEIQFDKLGAFVYSDK----------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2qgqA           ----------------------------------------------------------------------
2qgqC           ----------------------------------------------------------------------
2qgqB           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxx
2qgqA           --------------
2qgqC           --------------
2qgqB           --------------