[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE2125

[Show Plain Result]

#ERROR : Can't open dsspfile "2qtmA.bssp"
#ERROR : Can't open dsspfile "3e27B.bssp"
#ERROR : Can't open dsspfile "1kaqA.bssp"
#ERROR : Can't open dsspfile "2qtrA.bssp"
#ERROR : Can't open dsspfile "3e27D.bssp"
#ERROR : Can't open dsspfile "3e27A.bssp"
#ERROR : Can't open dsspfile "3dv2B.bssp"
#ERROR : Can't open dsspfile "3dv2A.bssp"
#ERROR : Can't open dsspfile "2h29A.bssp"
#ERROR : Can't open dsspfile "1kamC.bssp"
#ERROR : Can't open dsspfile "1kamA.bssp"
#ERROR : Can't open dsspfile "1kamB.bssp"
#ERROR : Can't open dsspfile "2h2aA.bssp"
#ERROR : Can't open dsspfile "1kaqE.bssp"
#ERROR : Can't open dsspfile "1kamD.bssp"
#ERROR : Can't open dsspfile "1yunA.bssp"
#ERROR : Can't open dsspfile "1yumA.bssp"
#ERROR : Can't open dsspfile "1kaqF.bssp"
#ERROR : Can't open dsspfile "1k4mA.bssp"
#ERROR : Can't open dsspfile "1k4kD.bssp"
#ERROR : Can't open dsspfile "1yulA.bssp"
#ERROR : Can't open dsspfile "1k4kB.bssp"
#ERROR : Can't open dsspfile "1kqnB.bssp"
#ERROR : Can't open dsspfile "1nurB.bssp"
#ERROR : Can't open dsspfile "1nupB.bssp"
#ERROR : Can't open dsspfile "1nupA.bssp"
#ERROR : Can't open dsspfile "1nutA.bssp"
#ERROR : Can't open dsspfile "1kqoA.bssp"
#ERROR : Can't open dsspfile "1kqnA.bssp"
#ERROR : Can't open dsspfile "1kkuA.bssp"
#ERROR : Can't open dsspfile "1gryA.bssp"
#ERROR : Can't open dsspfile "1gzuA.bssp"
#ERROR : Can't open dsspfile "3h05B.bssp"
#ERROR : Can't open dsspfile "3h05A.bssp"
#ERROR : Can't open dsspfile "1lw7A.bssp"
#ERROR : Can't open dsspfile "1gn8A.bssp"

## Summary of PDB Search
:202
    2e-33  40%  2qtmA  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    2e-33  40%  3e27B  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    3e-33  38%  1kaqA  [c.26.1] NICOTINATE-NUCLEOTIDE ADENYLYLTRANSFERASE
    7e-33  39%  2qtrA  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    7e-33  39%  3e27D  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    7e-33  39%  3e27A  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    3e-32  39%  3dv2B  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    3e-32  39%  3dv2A  [x.x.x] NICOTINATE (NICOTINAMIDE) NUCLEOTIDE
    4e-28  36%  2h29A  [x.x.x] PROBABLE NICOTINATE-NUCLEOTIDE
    6e-28  37%  1kamC  [c.26.1] NICOTINATE-NUCLEOTIDE ADENYLYLTRANSFERASE
    6e-28  37%  1kamA  [c.26.1] NICOTINATE-NUCLEOTIDE ADENYLYLTRANSFERASE
    9e-28  39%  1kamB  [c.26.1] NICOTINATE-NUCLEOTIDE ADENYLYLTRANSFERASE
    2e-27  36%  2h2aA  [x.x.x] PROBABLE NICOTINATE-NUCLEOTIDE
    4e-27  36%  1kaqE  [c.26.1] NICOTINATE-NUCLEOTIDE ADENYLYLTRANSFERASE
    7e-26  38%  1kamD  [c.26.1] NICOTINATE-NUCLEOTIDE ADENYLYLTRANSFERASE
    5e-23  30%  1yunA  [x.x.x] PROBABLE NICOTINATE-NUCLEOTIDE
    5e-23  30%  1yumA  [x.x.x] 'PROBABLE NICOTINATE-NUCLEOTIDE
    5e-23  36%  1kaqF  [c.26.1] NICOTINATE-NUCLEOTIDE ADENYLYLTRANSFERASE
    3e-21  30%  1k4mA  [c.26.1] NAMN ADENYLYLTRANSFERASE
    1e-20  30%  1k4kD  [c.26.1] NICOTINIC ACID MONONUCLEOTIDE
    4e-20  30%  1yulA  [x.x.x] PROBABLE NICOTINATE-NUCLEOTIDE
    5e-18  30%  1k4kB  [c.26.1] NICOTINIC ACID MONONUCLEOTIDE
    6e-09  26%  1kqnB  [c.26.1] NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
    1e-08  27%  1nurB  [c.26.1] FKSG76
    1e-08  27%  1nupB  [c.26.1] FKSG76
    1e-08  27%  1nupA  [c.26.1] FKSG76
    2e-08  27%  1nutA  [c.26.1] FKSG76
    2e-08  26%  1kqoA  [c.26.1] NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
    2e-08  26%  1kqnA  [c.26.1] NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
    6e-08  26%  1kkuA  [c.26.1] NICOTINAMIDE MONONUCLEOTIDE ADENYLYLTRANSFERASE
    2e-07  27%  1gryA  [x.x.x] NICOTINAMIDE MONONUCLEOTIDE ADENYLYL
    2e-07  27%  1gzuA  [c.26.1] NICOTINAMIDE MONONUCLEOTIDE ADENYLYL TRANSFERASE
    6e-06  28%  3h05B  [x.x.x] UNCHARACTERIZED PROTEIN VPA0413
    1e-04  28%  3h05A  [x.x.x] UNCHARACTERIZED PROTEIN VPA0413
    4e-04  55%  1lw7A  [c.26.1 - c.37.1] TRANSCRIPTIONAL REGULATOR NADR
    7e-04  44%  1gn8A  [c.26.1] PHOSPHOPANTETHEINE ADENYLYLTRANSFERASE
:202

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKKIGVFGGTFDPIHIGHIYIAYEAYKILELDEVIFMPAGNPPHKKWKDITDEIIRYEMVKKAIEPYSFF
2qtmA           MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDITSVESRLQMLELATEAEEHF
3e27B           MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDITSVESRLQMLELATEAEEHF
1kaqA           -KKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMPNQIPPHKQNEDYTDSFHRVEMLKLAIQSNPSF
2qtrA           MRKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHF
3e27D           -RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDITSVESRLQMLELATEAEEHF
3e27A           -RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRDITSVESRLQMLELATEAEEHF
3dv2B           -RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHF
3dv2A           -RKIGIIGGTFDPPHYGHLLIANEVYHALNLEEVWFLPNQIPPHKQGRNITSVESRLQMLELATEAEEHF
2h29A           MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHHDFIDVQHRLTMIQMIIDELGFG
1kamC           -KKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMP---------NQIPDSFHRVEMLKLAIQSNPSF
1kamA           -KKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMP---------NQIPDSFHRVEMLKLAIQSNPSF
1kamB           -KKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMPNQIPPH------TDSFHRVEMLKLAIQSNPSF
2h2aA           MKKIVLYGGQFNPIHTAHMIVASEVFHELQPDEFYFLPSFMSPLKKHHDFIDVQHRLTMIQMIIDELGFG
1kaqE           -KKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMP----------NQIDSFHRVEMLKLAIQSNPSF
1kamD           -KKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMP---------NQITDSFHRVEMLKLAIQSNPSF
1yunA           -KRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVS-AAQRLAMVERAVAGVERL
1yumA           -KRIGLFGGTFDPVHIGHMRSAVEMAEQFALDELRLLPNARPPHRETPQVS-AAQRLAMVERAVAGVERL
1kaqF           -KKIGIFGGTFDPPHNGHLLMANEVLYQAGLDEIWFMP----------NQIDSFHRVEMLKLAIQSNPSF
1k4mA           -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
1k4kD           -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
1yulA           -KRIGLFGGTFDPVHIGH-RSAVEAEQ-FALDELRLLPNARPPHRETPQVS--AAQRLAVERAVAGVERL
1k4kB           -----LFGGTFDPVHYGHLKPVETLANLIGLTRVTIIPNNVPPHRPQPE-ANSVQRKHMLELAIADKPLF
1kqnB           --------GSFNPITNMHLRLFELAKDYMNVVKGIISPVGDAYKKK--GLIPAYHRVIMAELATKNSKWV
1nurB           --------GSFNPITNMHLRMFEVARDHLQVIQGIISPVNDTYGKK--DLAASHHRVAMARLALQTSDWI
1nupB           --------GSFNPITNMHLRMFEVARDHLQVIQGIISPVNDTYGKK--DLAASHHRVAMARLALQTSDWI
1nupA           --------GSFNPITNMHLRMFEVARDHLQVIQGIISPVNDTYGKK--DLAASHHRVAMARLALQTSDWI
1nutA           --------GSFNPITNMHLRMFEVARDHLQVIQGIISPVNDTYGKK--DLAASHHRVAMARLALQTSDWI
1kqoA           --------GSFNPITNMHLRLFELAKDYMNVVKGIISPVGDAYKKK--GLIPAYHRVIMAELATKNSKWV
1kqnA           --------GSFNPITNMHLRLFELAKDYMNVVKGIISPVGDAYKKK--GLIPAYHRVIMAELATKNSKWV
1kkuA           --------GSFNPITNMHLRLFELAKDYMNVVKGIISPVGDAYKKK--GLIPAYHRVIMAELATKNSKWV
1gryA           ----------------------------------------------------------------------
1gzuA           ----------------------------------------------------------------------
3h05B           MKKIAIFGSAFNPPSLGHKSV---IESLSHFDLVLLEPSIN--------MLDYPIRCKLVDAFIKDMGLS
3h05A           MKKIAIFGSAFNPPSLGHKSV---IESLSHFDLVLLEPS---------IMLDYPIRCKLVDAFIKDMGLS
1lw7A           -KKVGVIFGKFYPVHTGHINI-YEAFKVDELHVIV-----------------------------------
1gn8A           MQKRAIYPGTFDPITNGHIDIVTRATQM--FDHVILAIAASPSKK-------------------------


                         .         .         *         .         .         .         .:140
query           SINNYEIEKKGLSFTYETLRYLHESFKEVELYFITGADCLVNLNSWKNINEIFKFSNLVVFNRPGFDKND
2qtmA           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGY----
3e27B           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGY----
1kaqA           KLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFIIGADMIEYLPKWYKLDELLNLIQFIGVKRPGFHV--
2qtrA           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGY----
3e27D           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGY----
3e27A           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGY----
3dv2B           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGY----
3dv2A           SICLEELSRKGPSYTYDTMLQLTKKYPDVQFHFIIGGDMVEYLPKWYNIEALLDLVTFVGVARPGY----
2h29A           DICDDEIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
1kamC           KLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFIIGADMIEYLPKWYKLDELLNLIQFIGVKRPGFHV--
1kamA           KLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFIIGADMIEYLPKWYKLDELLNLIQFIGVKRPGFHV--
1kamB           KLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFIIGADMIEYLPKWYKI-------QFIGVKRPGFHV--
2h2aA           DIDD-EIKRGGQSYTYDTIKAFKEQHKDSELYFVIGTDQYNQLEKWYQIEYLKEMVTFVVVNR---DKN-
1kaqE           KLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFIIGADMIEYLPKWYKLDELLNLIQFIGVKRPGFHV--
1kamD           KLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFIIGADMIEYLPKWYKL-----LIQFIGVKRPGFHV--
1yunA           TVDPRELQRDKPSYTIDTLESVRELAADDQLFMLIGWDAFCGLPTWHRWEALLDHCHIVVLQRPDADSRD
1yumA           TVDPRELQRDKPSYTIDTLESVRELAADDQLFMLIGWDAFCGLPTWHRWEALLDHCHIVVLQRPDADSRD
1kaqF           KLELVEMEREGPSYTFDTVSLLKQRYPNDQLFFIIGADMIEYLPKWYKLDELLNLIQFIVVETP------
1k4mA           TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
1k4kD           TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQDSLLTFPTWYEYETILDNAHLIVCRRPGYPEDH
1yulA           TVDPRELQRDKPSYTIDTLESVRAELAADDQLFLIGWDAFCGLPTWHRWEALLDHCHIVVLQRPDADSRD
1k4kB           TLDERELKRNAPSYTAQTLKWRQEQGPDVPLAFIIGQD---------SLETILDNAHLIVCRRPGYPEDH
1kqnB           EVDTWESLQKEWKETLKVLRHHQEKLEAVKVKLLCGADLLESFNLWKSITQIVANYGLICVTRAGNDAQK
1nurB           RVDPWESEQAQWMETVKVLRHHHSKLLRVELKLLCGADVLKTFNLWKDIQEIVEKFGLVCVGRVSHDPKG
1nupB           RVDPWESEQAQWMETVKVLRHHHSKLLRVELKLLCGADVLKTFNLWKDIQEIVEKFGLVCVGRVSHDPKG
1nupA           RVDPWESEQAQWMETVKVLRHHHSKLLAVELKLLCGADVLKTFNLWKDIQEIVEKFGLVCVGRVSHDPKG
1nutA           RVDPWESEQAQWMETVKVLRHHHSKLLAVELKLLCGADVLKTFNLWKDIQEIVEKFGLVCVGRVSHDPKG
1kqoA           EVDTWESLQKEWKETLKVLRHHQEKLEAAKVKLLCGADLLESFNLWKSITQIVANYGLICVTRAGNDAQK
1kqnA           EVDTWESLQKEWKETLKVLRHHQEKLEAAKVKLLCGADLLESFNLWKSITQIVANYGLICVTRAGNDAQK
1kkuA           EVDTWESLQKEWKETLKVLRHHQEKLEASDVKLLCGADLLESFNLWKSITQIVANYGLICVTRAGNDAQK
1gryA           -VDTWESLQKEWKETLKVLRH-HQEKAVPKVKLLCGADLLESFNLWKSITQIVANYGLICVTRAGNDAQK
1gzuA           -VDTWESLQKEWKETLKVLRHHQEKLEAAKVKLLCGADLLESFNLWKSITQIVANYGLICVTRAGNDAQK
3h05B           NVQRSDLEQALYVTTYALLEKIQEIYPTADITFVIGPD--------------------------------
3h05A           NVQRSDLEQALYSVTYALLEKIQEIYPTADITFVIGPD--------------------------------
1lw7A           ----------------------------------------------------------------------
1gn8A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LLKRKEEFDREYCTNIVYLDLLNIEISSTLIRERVRESLEVKFFLPPGVVDIIDKYNLYRRE
2qtmA           --KLRTPYP------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
3e27B           --KLRTPYP------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
1kaqA           ----------ETPYPLLFADVPEFEVSSTMIRERFKSKKPTDYLIPDKVKKYVEENGLY---
2qtrA           --KLRTPYP------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
3e27D           --KLRTPYP------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
3e27A           --KLRTPYP------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
3dv2B           --KLRTPYP------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
3dv2A           --KLRTPYP------ITTVEIPEFAVSSSLLRERYKEKKTCKYLLPEKVQVYIERNGLY---
2h29A           --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
1kamC           ----------ETPYPLLFADVPEFEVSSTMIRERFKSKKPTDYLIPDKVKKYVEENGLY---
1kamA           ----------ETPYPLLFADVPEFEVSSTMIRERFKSKKPTDYLIPDKVKKYVEENGLY---
1kamB           ----------ETPYPLLFADVPEFEVSSTMIRERFKSKKPTDYLIPDKVKKYVEENGLY---
2h2aA           --------SQNVENAMIAIQIPRVDISSTMIRQRVSEGKSIQVLVPKSVENYIKGEGLY---
1kaqE           ----------ETPYPLLFADVPEFEVSSTMIRERFKSKKPTDYLIPDKVKKYVEENGLY---
1kamD           ----------ETPYPLLFADVPEFEVSSTMIRERFKSKKPTDYLIPDKVKKYVEENGLY---
1yunA           LLAARSVADPQALKQITFVWQTPLAVSATQIRALLGAGRSVRFLVPDAVLNYIEAHHLYR--
1yumA           LLAARSVADPQALKQITFVWQTPLAVSATQIRALLGAGRSVRFLVPDAVLNYIEAHHLYR--
1kaqF           -------------YPLLFADVPEFEVSSTMIRERFKSKKPTDYLIPDKVKKYVEE-------
1k4mA           LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
1k4kD           LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLY---
1yulA           LLAARSVADPQALKQITFVWQTPLAVSATQIRALLGAGRSVRFLVPDAVLNYIEAHHLYR--
1k4kB           LTHNPEDLHLQPAGKIYLAETPWFNISATIIRERLQNGESCEDLLPEPVLTYINQQGLYR--
1kqnB           FIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSE
1nurB           YIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLY---
1nupB           YIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLY---
1nupA           YIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTK-
1nutA           YIAESPILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLY---
1kqoA           FIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSE
1kqnA           FIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSE
1kkuA           FIYESDVLWKHRSNIHVVNEWFANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSE
1gryA           FIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSE
1gzuA           FIYESDVLWKHRSNIHVVNEWIANDISSTKIRRALRRGQSIRYLVPDLVQEYIEKHNLYSSE
3h05B           --------------------------------------------------------------
3h05A           --------------------------------------------------------------
1lw7A           --------------------------------------------------------------
1gn8A           --------------------------------------------------------------