[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:nagA

[Show Plain Result]

#ERROR : Can't open dsspfile "3iv8A.bssp"
#ERROR : Can't open dsspfile "3egjA.bssp"
#ERROR : Can't open dsspfile "2vhlB.bssp"
#ERROR : Can't open dsspfile "2vhlA.bssp"
#ERROR : Can't open dsspfile "3iv8D.bssp"
#ERROR : Can't open dsspfile "3egjB.bssp"
#ERROR : Can't open dsspfile "2p50A.bssp"
#ERROR : Can't open dsspfile "2p53A.bssp"
#ERROR : Can't open dsspfile "1yrrA.bssp"
#ERROR : Can't open dsspfile "1ymyA.bssp"
#ERROR : Can't open dsspfile "2p50C.bssp"
#ERROR : Can't open dsspfile "2p50D.bssp"
#ERROR : Can't open dsspfile "2p50B.bssp"
#ERROR : Can't open dsspfile "1yrrB.bssp"
#ERROR : Can't open dsspfile "1ymyB.bssp"
#ERROR : Can't open dsspfile "1o12A.bssp"
#ERROR : Can't open dsspfile "3griB.bssp"
#ERROR : Can't open dsspfile "3griA.bssp"
#ERROR : Can't open dsspfile "1gkrA.bssp"
#ERROR : Can't open dsspfile "1xrtB.bssp"
#ERROR : Can't open dsspfile "1xrtA.bssp"
#ERROR : Can't open dsspfile "1xrfA.bssp"
#ERROR : Can't open dsspfile "2fvkD.bssp"
#ERROR : Can't open dsspfile "2ftyD.bssp"
#ERROR : Can't open dsspfile "2ftyC.bssp"
#ERROR : Can't open dsspfile "2ftyA.bssp"
#ERROR : Can't open dsspfile "3d6nA.bssp"
#ERROR : Can't open dsspfile "1ybqA.bssp"
#ERROR : Can't open dsspfile "1gkpA.bssp"
#ERROR : Can't open dsspfile "2ftwA.bssp"
#ERROR : Can't open dsspfile "1k1dA.bssp"
#ERROR : Can't open dsspfile "2aqvB.bssp"
#ERROR : Can't open dsspfile "2aqvA.bssp"
#ERROR : Can't open dsspfile "1ybqB.bssp"
#ERROR : Can't open dsspfile "1pokA.bssp"
#ERROR : Can't open dsspfile "1pokB.bssp"
#ERROR : Can't open dsspfile "1pojA.bssp"
#ERROR : Can't open dsspfile "1po9A.bssp"
#ERROR : Can't open dsspfile "1onxA.bssp"
#ERROR : Can't open dsspfile "1onwB.bssp"
#ERROR : Can't open dsspfile "1onwA.bssp"
#ERROR : Can't open dsspfile "2aqoB.bssp"
#ERROR : Can't open dsspfile "2aqoA.bssp"
#ERROR : Can't open dsspfile "2z00A.bssp"
#ERROR : Can't open dsspfile "1nfgA.bssp"
#ERROR : Can't open dsspfile "3hm7C.bssp"
#ERROR : Can't open dsspfile "3hm7B.bssp"
#ERROR : Can't open dsspfile "3hm7A.bssp"
#ERROR : Can't open dsspfile "3dugC.bssp"
#ERROR : Can't open dsspfile "3dugA.bssp"
#ERROR : Can't open dsspfile "3be7C.bssp"
#ERROR : Can't open dsspfile "3be7B.bssp"
#ERROR : Can't open dsspfile "3be7A.bssp"
#ERROR : Can't open dsspfile "1p1mA.bssp"
#ERROR : Can't open dsspfile "3e74B.bssp"
#ERROR : Can't open dsspfile "3dc8B.bssp"
#ERROR : Can't open dsspfile "3dc8A.bssp"
#ERROR : Can't open dsspfile "3e74A.bssp"
#ERROR : Can't open dsspfile "2r8cF.bssp"
#ERROR : Can't open dsspfile "2r8cD.bssp"
#ERROR : Can't open dsspfile "2r8cB.bssp"
#ERROR : Can't open dsspfile "2r8cA.bssp"
#ERROR : Can't open dsspfile "3gnhA.bssp"
#ERROR : Can't open dsspfile "3e74C.bssp"
#ERROR : Can't open dsspfile "2vr2A.bssp"

## Summary of PDB Search
:378
    2e-63  39%  3iv8A  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    2e-63  39%  3egjA  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    7e-61  36%  2vhlB  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    7e-61  36%  2vhlA  [b.92.1 - c.1.9 (1un7A)] N-ACETYLGLUCOSAMINE-6-PHOSPHATE
    8e-60  42%  3iv8D  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    3e-58  40%  3egjB  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    4e-53  36%  2p50A  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    2e-52  36%  2p53A  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    4e-51  36%  1yrrA  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    2e-50  36%  1ymyA  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    7e-48  39%  2p50C  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    2e-47  38%  2p50D  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    2e-47  38%  2p50B  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    3e-44  40%  1yrrB  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    5e-44  40%  1ymyB  [x.x.x] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    2e-43  38%  1o12A  [b.92.1 - c.1.9] N-ACETYLGLUCOSAMINE-6-PHOSPHATE DEACETYLASE
    4e-09  29%  3griB  [x.x.x] DIHYDROOROTASE
    4e-09  29%  3griA  [x.x.x] DIHYDROOROTASE
    3e-08  36%  1gkrA  [b.92.1 - c.1.9] NON-ATP DEPENDENT L-SELECTIVE HYDANTOINASE
    7e-08  42%  1xrtB  [x.x.x] DIHYDROOROTASE
    7e-08  42%  1xrtA  [x.x.x] DIHYDROOROTASE
    7e-08  42%  1xrfA  [x.x.x] DIHYDROOROTASE
    7e-08  32%  2fvkD  [x.x.x] DIHYDROPYRIMIDINASE
    7e-08  32%  2ftyD  [x.x.x] DIHYDROPYRIMIDINASE
    7e-08  32%  2ftyC  [x.x.x] DIHYDROPYRIMIDINASE
    7e-08  32%  2ftyA  [x.x.x] DIHYDROPYRIMIDINASE
    7e-08  42%  3d6nA  [x.x.x] DIHYDROOROTASE
    3e-07  24%  1ybqA  [x.x.x] ISOASPARTYL DIPEPTIDASE
    1e-06  34%  1gkpA  [b.92.1 - c.1.9] HYDANTOINASE
    2e-06  47%  2ftwA  [x.x.x] DIHYDROPYRIMIDINE AMIDOHYDROLASE
    2e-06  41%  1k1dA  [b.92.1 - c.1.9] D-HYDANTOINASE
    3e-06  30%  2aqvB  [x.x.x] ISOASPARTYL DIPEPTIDASE
    3e-06  30%  2aqvA  [x.x.x] ISOASPARTYL DIPEPTIDASE
    5e-06  48%  1ybqB  [x.x.x] ISOASPARTYL DIPEPTIDASE
    5e-06  48%  1pokA  [b.92.1 - c.1.9] ISOASPARTYL DIPEPTIDASE
    5e-06  48%  1pokB  [b.92.1 - c.1.9] ISOASPARTYL DIPEPTIDASE
    5e-06  48%  1pojA  [b.92.1 - c.1.9] ISOASPARTYL DIPEPTIDASE
    5e-06  48%  1po9A  [b.92.1 - c.1.9] ISOASPARTYL DIPEPTIDASE
    5e-06  48%  1onxA  [b.92.1 - c.1.9] ISOASPARTYL DIPEPTIDASE
    5e-06  48%  1onwB  [b.92.1 - c.1.9] ISOASPARTYL DIPEPTIDASE
    5e-06  48%  1onwA  [b.92.1 - c.1.9] ISOASPARTYL DIPEPTIDASE
    5e-06  48%  2aqoB  [x.x.x] ISOASPARTYL DIPEPTIDASE
    5e-06  48%  2aqoA  [x.x.x] ISOASPARTYL DIPEPTIDASE
    2e-05  43%  2z00A  [x.x.x] DIHYDROOROTASE
    2e-05  45%  1nfgA  [b.92.1 - c.1.9] D-HYDANTOINASE
    2e-05  35%  3hm7C  [x.x.x] ALLANTOINASE
    2e-05  35%  3hm7B  [x.x.x] ALLANTOINASE
    2e-05  35%  3hm7A  [x.x.x] ALLANTOINASE
    4e-05  45%  3dugC  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    4e-05  45%  3dugA  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    4e-05  45%  3be7C  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    4e-05  45%  3be7B  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    4e-05  45%  3be7A  [x.x.x] ZN-DEPENDENT ARGININE CARBOXYPEPTIDASE
    6e-05  41%  1p1mA  [b.92.1 - c.1.9] HYPOTHETICAL PROTEIN TM0936
    6e-05  30%  3e74B  [x.x.x] ALLANTOINASE
    7e-05  36%  3dc8B  [x.x.x] DIHYDROPYRIMIDINASE
    7e-05  36%  3dc8A  [x.x.x] DIHYDROPYRIMIDINASE
    9e-05  33%  3e74A  [x.x.x] ALLANTOINASE
    1e-04  39%  2r8cF  [x.x.x] PUTATIVE AMIDOHYDROLASE
    1e-04  39%  2r8cD  [x.x.x] PUTATIVE AMIDOHYDROLASE
    1e-04  39%  2r8cB  [x.x.x] PUTATIVE AMIDOHYDROLASE
    1e-04  39%  2r8cA  [x.x.x] PUTATIVE AMIDOHYDROLASE
    1e-04  23%  3gnhA  [x.x.x] L-LYSINE, L-ARGININE CARBOXYPEPTIDASE CC2672
    2e-04  35%  3e74C  [x.x.x] ALLANTOINASE
    6e-04  35%  2vr2A  [x.x.x] DIHYDROPYRIMIDINASE
:378

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLIKNCNIVYLDKIEKGNILIENGKIKAINPKEECDCEVIDGEGLFLSPGFIDVHIHGAGGHDTMDGTYE
3iv8A           --LTNCKIYTNDVLVKHAVIINGDKIEAVCPIESLPSEVVDLNGANLSPGFIDLQLNGCGGVMFNDETAE
3egjA           --LTNCKIYTNDVLVKHAVIINGDKIEAVCPIESLPSEVVDLNGANLSPGFIDLQLNGCGGVMFNDETAE
2vhlB           LLIKDIAIVTENEVIKGYVGINDGKISTVSPKEPYSKEIQAPADSVLLPGMIDIHIHGGYGADTMDASFS
2vhlA           LLIKDIAIVTENEVIKGYVGINDGKISTVSPKEPYSKEIQAPADSVLLPGMIDIHIHGGYGADTMDASFS
3iv8D           --LTNCKIYTNDVLVKHAVIINGDKIEAVCPIESLPSEVVDLNGANLSPGFIDLQLNGCGGVMFNDETAE
3egjB           --LTNCKIYTNDVLVKHAVIINGDKIEAVCPIESLPSEVVDLNGANLSPGFIDLQLNGCGGVMFNDETAE
2p50A           ------------------VVIADGLIKSVCPVAELPPEIEQRSGAILSPGFIDVQLNGCGGNDTAEASVE
2p53A           ------------------VVIADGLIKSVCPVAELPPEIEQRSGAILSPGFIDVQLNGCGGNDTAEASVE
1yrrA           ------------------VVIADGLIKSVCPVAELPPEIEQRSGAILSPGFIDVQLNGCGGNDTAEASVE
1ymyA           ------------------VVIADGLIKSVCPVAELPPEIEQRSGAILSPGFIDVQLNGCGGNDTAEASVE
2p50C           ------------------VVIADGLIKSVCPVAELPPEIEQRSGAILSPGFIDVQLNGCGGNDTAEASVE
2p50D           ------------------VVIADGLIKSVCPVAELPPEIEQRSGAILSPGFIDVQLNGCGGNDTAEASVE
2p50B           ------------------VVIADGLIKSVCPVAELPPEIEQRSGAILSPGFIDVQLNGCGGNDTAEASVE
1yrrB           ------------------VVIADGLIKSVCPVAELPPEIEQRSGAILSPGFIDVQLNGCGGNDTAEASVE
1ymyB           ------------------VVIADGLIKSVCPVAELPPEIEQRSGAILSPGFIDVQLNGCGGVQ-FAVSVE
1o12A           ------------------------------------------------PGFVDPHIHGVVGADTNCDFSE
3griB           -LIKNGKVLQNGELQQADILIDGKVIKQIAPAIEPSVDIIDAKGHFVSPGFVDVHVHEPGGE-----YKE
3griA           -LIKNGKVLQNGELQQADILIDGKVIKQIAPAIEPSVDIIDAKGHFVSPGFVDVHVHEPGGE-----YKE
1gkrA           VIVKNCRLVSSDGITEADILVKDGKVAAIS-ADTSDVETIDAGGKFVMPGVVDEHVHNRYGRFELDSESA
1xrtB           LIVKNGYVIDPSQNLEGDILVENGKIKKIDKNILVEAEIIDAKGLIVCPGFIDIHVH-------------
1xrtA           LIVKNGYVIDPSQNLEGDILVENGKIKKIDKNILVEAEIIDAKGLIVCPGFIDIHVH-------------
1xrfA           LIVKNGYVIDPSQNLEGDILVENGKIKKIDKNILVEAEIIDAKGLIVCPGFIDIHVH-------------
2fvkD           LIIKNGIICTASDIYAAEIAVNNGKVQLIAASIDLGSEVIDAEGAFITPGGIDAHVHVDEPLKLLGDVVD
2ftyD           LIIKNGIICTASDIYAAEIAVNNGKVQLIAASIDLGSEVIDAEGAFITPGGIDAHVHVDEPLKLLGDVVD
2ftyC           LIIKNGIICTASDIYAAEIAVNNGKVQLIAASIDLGSEVIDAEGAFITPGGIDAHVHVDEPLKLLGDVVD
2ftyA           LIIKNGIICTASDIYAAEIAVNNGKVQLIAASIDLGSEVIDAEGAFITPGGIDAHVHVDEPLKLLGDVVD
3d6nA           LIVKNGYVIDPSQNLEGDILVENGKIKKIDKNILVEAEIIDAKGLIVCPGFIDIHVH-------------
1ybqA           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTR
1gkpA           LLIKNGEIITADSRYKADIYAEGETITRIGQNLEAPTEVIDATGKYVFPGFIDPHVHATFAKDTHETG--
2ftwA           ILIKNGTVVNDDRYFKSDVLVENGIIKEISPKE--GIKVVDATDKLLLPGGIDTHTH-------------
1k1dA           -IIKNGTIVTATDTYEAHLLIKDGKIAMIGQNEEKGAEVIDAKGCYVFPGGIDPHTH-------------
2aqvB           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTR
2aqvA           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGGGGEAGPTTR
1ybqB           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGG---------
1pokA           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGG---------
1pokB           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGG---------
1pojA           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGG---------
1po9A           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGG---------
1onxA           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGG---------
1onwB           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGG---------
1onwA           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGG---------
2aqoB           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGG---------
2aqoA           -----------------DVLVANGKIIAVASNIPSDCTVVDLSGQILCPGFIDQHVHLIGG---------
2z00A           ILIRNVRLVDA-RGERGDVLIGEGRILSLEGGEAK--QVVDGTGCFLAPGFLDLHAH-------------
1nfgA           IIIKNGTIVTADGISRADLGIKDGKITALGPAER----TIDAAGRYVFPGGIDVHTH-------------
3hm7C           LIIRSSTVVTETTTYRADVAIRNGIVSAITEPGSIDGPAIDGTGLHLFPGMVDVHVH-------------
3hm7B           LIIRSSTVVTETTTYRADVAIRNGIVSAITEPGSIDGPAIDGTGLHLFPGMVDVHVH-------------
3hm7A           LIIRSSTVVTETTTYRADVAIRNGIVSAITEPGSIDGPAIDGTGLHLFPGMVDVHVH-------------
3dugC           ---------YLDEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHIVG----------
3dugA           ---------YLDEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHIVG----------
3be7C           ---------YLDEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHIVG----------
3be7B           ---------YLDEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHIVG----------
3be7A           ---------YLDEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLMDSHVHIVG----------
1p1mA           ----------------------------------------------------------------------
3e74B           LIIKNGTVILENEARVVDIAVKGGKIAAIG-QDLGDAKEVDASGLVVSPG-VDAHTHISHWEGYETGT--
3dc8B           -VIKGGTIVTADLTYKADVKVEGGRIVEIGPNLS-GAETLDATGCYVMPGGIDPHTH-------------
3dc8A           -VIKGGTIVTADLTYKADVKVEGGRIVEIGPNLS-GAETLDATGCYVMPGGIDPHTH-------------
3e74A           LIIKNGTVILENEARVVDIAVKGGKIAAIG-QDLGDAKEVDASGLVVSPG-VDAHTH--IGYET--GT--
2r8cF           -----------DLLQGFEILIEDGFIREVSDKKSSNAHVIDVKGKTIMPGLIDLHVH-------------
2r8cD           -----------DLLQGFEILIEDGFIREVSDKKSSNAHVIDVKGKTIMPGLIDLHVH-------------
2r8cB           -----------DLLQGFEILIEDGFIREVSDKKSSNAHVIDVKGKTIMPGLIDLHVH-------------
2r8cA           -----------DLLQGFEILIEDGFIREVSDKKSSNAHVIDVKGKTIMPGLIDLHVH-------------
3gnhA           ------------------VIVTDGRITSIGKKGDAGATAVDLPGVTLLPGLIDMHVHEVGGYNSLEYSDR
3e74C           LIIKNGTVILENEARVVDIAVKGGKIAAIG-QDLGDAKEVDASGLVVSPG-VDAHTH-------------
2vr2A           LLIRGGRVVNDDFSEVADVLVEDGVVRALG-----HLRVLDAAGKLVLPGGIDTHTH-------------


                         .         .         *         .         .         .         .:140
query           AINEISKVIVKHGTTSFLPTTMTVAAEDVCKSMEAIHKAKTEGTDGANVLGAHLEGPFISTSAIGAQNPD
3iv8A           TIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKYPNQS--LGLHLEGPYLNVMKKGIHSVD
3egjA           TIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKYPNQS--LGLHLEGPYLNVMKKGIHSVD
2vhlB           TLDIMSSRLPEEGTTSFLATTITQEHGNISQALVNAREWKXXXXXXXXXXXXHLEGPFVSPKRAGAQPKE
2vhlA           TLDIMSSRLPEEGTTSFLATTITQEHGNISQALVNAREWKXXXXXXXXXXXXHLEGPFVSPKRAGAQPKE
3iv8D           TIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKYPNQS--LGLHLEGPYLNVMKKGIHSVD
3egjB           TIDTMHKANLKSGCTSFLPTLITSSDENMRQAIAAAREYQAKYPNQS--LGLHLEGP-------------
2p50A           TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQA--LGLHLEGPWLNLVKKGTHNPN
2p53A           TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQA--LGLHLEGPWLNLVKKGTHNPN
1yrrA           TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQA--LGLHLEGPWLNLVK-KTHNPN
1ymyA           TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQA--LGLHLEGPWLNLVPNFVRKPD
2p50C           TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQA--LGLHLEGPWLNLVKKGTHNPN
2p50D           TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQA--LGLHLEGPWLNLVKKGTHNPN
2p50B           TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQA--LGLHLEGPWLNLVKKGTHNPN
1yrrB           TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQA--LGLHLEGPWLNAALV-----D
1ymyB           TLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAKHPNQA--LGLHLEGPWLNLAAL----VD
1o12A           -----EEFLYSQGVTTFLATTVSTSLE----KKEILRKARDYILENTSLLGVHLEGPYISKEKKGAHSEK
3griB           TIETGTKAAARGGFTTVCPPN-TRPVPDSVEHFEALQKAQVRVLPYASILGKELEGAFAFTDGVGVQTAS
3griA           TIETGTKAAARGGFTTVCPPN-TRPVPDSVEHFEALQKAQVRVLPYASILGKELEGAFAFTDGVGVQTAS
1gkrA           AVGGITTII--EMPITFPPTT-------------------------------------------------
1xrtB           ----------------------------------------------------------------------
1xrtA           ----------------------------------------------------------------------
1xrfA           ----------------------------------------------------------------------
2fvkD           TMEHATRSAVAGGTT----TVVAFSTQDVSK---------------------------------------
2ftyD           TMEHATRSAVAGGTT----TVVAFSTQDVSK---------------------------------------
2ftyC           TMEHATRSAVAGGTT----TVVAFSTQDVSK---------------------------------------
2ftyA           TMEHATRSAVAGGTT----TVVAFSTQDVSK---------------------------------------
3d6nA           ----------------------------------------------------------------------
1ybqA           TPEVALSRLTEAGVTSVVG---LLGTDSISRHPESL-LAKTRALNEEGISAWMLTGAYPSRTITGSVEKD
1gkpA           -----SKAALMGGTTTYIEMCCPSRNDDALEGYQ-LWKSKAEG---------------------------
2ftwA           ----------------------------------------------------------------------
1k1dA           ----------------------------------------------------------------------
2aqvB           TPEVALSRLTEAGVTSVVG---LLGTDSISRHPESL-LAKTRALNEEGISAWMLTGAF------------
2aqvA           TPEVALSRLTEAGVTSVVG---LLGTDSISRHPESL-LAKTRALNEEGISAWMLTGAF------------
1ybqB           ----------------------------------------------------------------------
1pokA           ----------------------------------------------------------------------
1pokB           ----------------------------------------------------------------------
1pojA           ----------------------------------------------------------------------
1po9A           ----------------------------------------------------------------------
1onxA           ----------------------------------------------------------------------
1onwB           ----------------------------------------------------------------------
1onwA           ----------------------------------------------------------------------
2aqoB           ----------------------------------------------------------------------
2aqoA           ----------------------------------------------------------------------
2z00A           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
3hm7C           ----------------------------------------------------------------------
3hm7B           ----------------------------------------------------------------------
3hm7A           ----------------------------------------------------------------------
3dugC           ----------------------------------------------------------------------
3dugA           ----------------------------------------------------------------------
3be7C           ----------------------------------------------------------------------
3be7B           ----------------------------------------------------------------------
3be7A           ----------------------------------------------------------------------
1p1mA           ----------------------------------------------------------------------
3e74B           ------RAAAKGGITTIEPLNQLPATVDRASIELKFDAAKGKLTIDAAQLG-------------------
3dc8B           ----------------------------------------------------------------------
3dc8A           ----------------------------------------------------------------------
3e74A           ------RAAAKGGITTIEPLNQLPATVDRASIELKFDAAKGKLTIDAAQLG-------------------
2r8cF           ----------------------------------------------------------------------
2r8cD           ----------------------------------------------------------------------
2r8cB           ----------------------------------------------------------------------
2r8cA           ----------------------------------------------------------------------
3gnhA           FWSVVQTANAKKTLEAGFTTVRNVGAADY------DDVGLREAIDAGYVPGPRIVTAAISFGATGGHCDS
3e74C           ----------------------------------------------------------------------
2vr2A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FLIPPTKENFYKLVGEHEDDVVSITLAPEVEGAKELTKFLSEKGIVVSMGHTKATYEEAMEGIKCGCSHA
3iv8A           F-IRPSDDTMIDTICANSDVIAKVTLAPENNKPEHIEK-LVKAGIVVSIGHTNATYSEARKSFESGITFA
3egjA           F-IRPSDDTMIDTICANSDVIAKVTLAPENNKPEHIEK-LVKAGIVVSIGHTNATYSEARKSFESGITFA
2vhlB           WIRPSDVELFKKWQQEAGGLIKIVTLAPEEDQHFELIRHLKDESIIASMGHTXXXXXXXXXXXXXXXXHM
2vhlA           WIRPSDVELFKKWQQEAGGLIKIVTLAPEEDQHFELIRHLKDESIIASMGHTXXXXXXXXXXXXXXXXHM
3iv8D           F-IRPSDDTMIDTICANSDVIAKVTLAPENNKPEHIEK-LVKAGIVVSIGHTNATYSEARKSFESGITFA
3egjB           ------DDTMIDTICANSDVIAKVTLAPENNKPEHIEK-LVKAGIVVSIGHTNATYSEARKSFESGITFA
2p50A           FVRKPDAA-LVDFLCENADVITKVTLAPEMVPAEVISK-LANAGIVVSAGHSNATLKEAKAGFRAGITFA
2p53A           FVRKPDAA-LVDFLCENADVITKVTLAPEMVPAEVISK-LANAGIVVSAGHSNATLKEAKAGFRAGITFA
1yrrA           FVRKPDAA-LVDFLCENADVITKVTLAPEMVPAEVISK-LANAGIVVSAGHSNATLKEAKAGFRAGITFA
1ymyA           AAL-------VDFLCENADVITKVTLAPEMVPAEVISK-LANAGIVVSAGHSNATLKEAKAGFRAGITFA
2p50C           FVRKPDAA-LVDFLCENADVITKVTLAPEMVPAEVISK-LANAGIVVSAGHSNATLKEAKAGFRAGITFA
2p50D           FVRKPDAA-LVDFLCENADVITKVTLAPEMVPAEVISK-LANAGIVVSAGHSNATLKEAKAGFRAGITFA
2p50B           FVRKPDAA-LVDFLCENADVITKVTLAPEMVPAEVISK-LANAGIVVSAGHSNATLKEAKAGFRAGITFA
1yrrB           FLC------------ENADVITKVTLAPEMVPAEVISK-LANAGIVVSAGHSNATLKEAKAGFRAGITFA
1ymyB           FLC------------ENADVITKVTLAPEMVPAEVISK-LANAGIVVSAGHSNATLKEAKAGFRAGITFA
1o12A           HIRPPSERELSEI-----DSPAKLTFAPEIESSELLLR-LVKRDIVLSAGHSIATFEE-FKFYKEGVKRI
3griB           YEIEAAKVN-KAIVAHCEDNSLIYGGAHEGKRSKEL-------GIIPNICESVQIARDVLLAEAAGCHHV
3griA           YEIEAAKVN-KAIVAHCEDNSLIYGGAHEGKRSKEL-------GIIPNICESVQIARDVLLAEAAGCHHV
1gkrA           ----------------------------------------------------------------------
1xrtB           ----------------------------------------------------------------------
1xrtA           ----------------------------------------------------------------------
1xrfA           ----------------------------------------------------------------------
2fvkD           ----------------------------------------------------------------------
2ftyD           ----------------------------------------------------------------------
2ftyC           ----------------------------------------------------------------------
2ftyA           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
1ybqA           VAIIDRVIGVKCAISDHRSAAPDVYHLANMAAESRVGGLLGGKGVTVHMGDSKKALQDLLENCDVPISKP
1gkpA           ----------------------------------------------------------------------
2ftwA           ----------------------------------------------------------------------
1k1dA           ----------------------------------------------------------------------
2aqvB           ----------------------------------------------------------------------
2aqvA           ----------------------------------------------------------------------
1ybqB           ----------------------------------------------------------------------
1pokA           ----------------------------------------------------------------------
1pokB           ----------------------------------------------------------------------
1pojA           ----------------------------------------------------------------------
1po9A           ----------------------------------------------------------------------
1onxA           ----------------------------------------------------------------------
1onwB           ----------------------------------------------------------------------
1onwA           ----------------------------------------------------------------------
2aqoB           ----------------------------------------------------------------------
2aqoA           ----------------------------------------------------------------------
2z00A           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
3hm7C           ----------------------------------------------------------------------
3hm7B           ----------------------------------------------------------------------
3hm7A           ----------------------------------------------------------------------
3dugC           ----------------------------------------------------------------------
3dugA           ----------------------------------------------------------------------
3be7C           ----------------------------------------------------------------------
3be7B           ----------------------------------------------------------------------
3be7A           ----------------------------------------------------------------------
1p1mA           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3dc8B           ----------------------------------------------------------------------
3dc8A           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
2r8cF           ----------------------------------------------------------------------
2r8cD           ----------------------------------------------------------------------
2r8cB           ----------------------------------------------------------------------
2r8cA           ----------------------------------------------------------------------
3gnhA           TFFPPSMDQKNPFNSDSPDEARKAVRTLKKYGAQVI---ICATGGVFSRGNEPGQQQLTYEEMKAVVDEA
3e74C           ----------------------------------------------------------------------
2vr2A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           THLFNAMTPFTHREPGVVGAVFDSEITTETISDGIHIAYPSLRVAYKQKGTDKVLLITDAMMACCMPDGM
3iv8A           THLFNAMTPMVGREPGVVGAIYDTEVYAGIIADGFHVDYANIRIAHKIKG-EKLVLVTDATAPAGAEMDY
3egjA           THLFNAMTPMVGREPGVVGAIYDTEVYAGIIADGFHVDYANIRIAHKIKG-EKLVLVTDATAPAGAEMDY
2vhlB           THLYNAMSPFHHREPGVIGALAHDGFVTELIADGIHSHPLAAKLAFLAKGSSKLILITDSMRAKGLKDGV
2vhlA           THLYNAMSPFHHREPGVIGALAHDGFVTELIADGIHSHPLAAKLAFLAKGSSKLILITDSMRAKGLKDGV
3iv8D           THLFNAMTPMVGREPGVVGAIYDTEVYAGIIADGFHVDYANIRIAHKIKG-EKLVLVTDA----TAPAGA
3egjB           THLFNAMTPMVGREPGVVGAIYDTEVYAGIIADGFHVDYANIRIAHKIKG-EKLVLVTDATAPAGAEMDY
2p50A           THLYNAMPYITGREPGLAGAILDADIYCGIIADGLHVDYANIRNAKRLKG-DKLCLVTDATAPAGANIEQ
2p53A           THLYNAMPYITGREPGLAGAILDADIYCGIIADGLHVDYANIRNAKRLKG-DKLCLVTNATAPAGANIEQ
1yrrA           THLYNAMPYITGREPGLAGAILDADIYCGIIADGLHVDYANIRNAKRLKG-DKLCLVTDATAPAGANIEQ
1ymyA           THLYNAMPYITGREPGLAGAILDADIYCGIIADGLHVDYANIRNAKRLKG-DKLCLVTDATAPAGANIEQ
2p50C           THLYNAMPYITGREPGLAGAILDADIYCGIIADGLHVDYANIRNAKRLKG-DKLCLVTDA----TAPAG-
2p50D           THLYNAMPYITGREPGLAGAILDADIYCGIIADGLHVDYANIRNAKRLKG-DKLCLVTDA----------
2p50B           THLYNAMPYITGREPGLAGAILDADIYCGIIADGLHVDYANIRNAKRLKG-DKLCLVTDA----TAPAG-
1yrrB           THLYNAMPYITGREPGLAGAILDADIYCGIIADGLHVDYANIRNAKRLKG-DKLCLVTDA----------
1ymyB           THLYNAMPYITGREPGLAGAILDADIYCGIIADGLHVDYANIRNAKRLKG-DKLCLVTDA----------
1o12A           THFPNGLKPLHHREIGITGALLLDDVKLELICDGVHLSR-EVKLVYKVKKANGIVLVTDSISAAGLKDGT
3griB           CHVSTKESVRVIRDAKRAGIHVTAEVTTEDDIPGNNAIYPPLRSTEDREALLEGLL--DGTIDCIATD--
3griA           CHVSTKESVRVIRDAKRAGIHVTAEVTTEDDIPGNNAIYPPLRSTEDREALLEGLL--DGTIDCIATD--
1gkrA           ----------------------------------------------------------------------
1xrtB           ----------------------------------------------------------------------
1xrtA           ----------------------------------------------------------------------
1xrfA           ----------------------------------------------------------------------
2fvkD           ----------------------------------------------------------------------
2ftyD           ----------------------------------------------------------------------
2ftyC           ----------------------------------------------------------------------
2ftyA           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
1ybqA           THLFEQALEFARKTIDITSSIDEPVAPAEGIARAVQAGIPLARVTLSSNGNGSQPFFDD-----------
1gkpA           ----------------------------------------------------------------------
2ftwA           ----------------------------------------------------------------------
1k1dA           ----------------------------------------------------------------------
2aqvB           ----------------------------------------------------------------------
2aqvA           ----------------------------------------------------------------------
1ybqB           ----------------------------------------------------------------------
1pokA           ----------------------------------------------------------------------
1pokB           ----------------------------------------------------------------------
1pojA           ----------------------------------------------------------------------
1po9A           ----------------------------------------------------------------------
1onxA           ----------------------------------------------------------------------
1onwB           ----------------------------------------------------------------------
1onwA           ----------------------------------------------------------------------
2aqoB           ----------------------------------------------------------------------
2aqoA           ----------------------------------------------------------------------
2z00A           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
3hm7C           ----------------------------------------------------------------------
3hm7B           ----------------------------------------------------------------------
3hm7A           ----------------------------------------------------------------------
3dugC           ----------------------------------------------------------------------
3dugA           ----------------------------------------------------------------------
3be7C           ----------------------------------------------------------------------
3be7B           ----------------------------------------------------------------------
3be7A           ----------------------------------------------------------------------
1p1mA           ----------------------------------------------------------------------
3e74B           ----------------------------------------------------------------------
3dc8B           ----------------------------------------------------------------------
3dc8A           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
2r8cF           ----------------------------------------------------------------------
2r8cD           ----------------------------------------------------------------------
2r8cB           ----------------------------------------------------------------------
2r8cA           ----------------------------------------------------------------------
3gnhA           HMAGIKVAAHAHGASGIREAVRAGVDTIEHASEGIKLA--------------------------------
3e74C           ----------------------------------------------------------------------
2vr2A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           YSLGGQDVEVKNGAARLLSGSLAGSILTLDVAVKNIFKNTNYPLNEVIKMATYNGAKHCKVDDKKGLIKE
3iv8A           FIFVGKKVYYRDGKCVDENGTLGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKK
3egjA           FIFVGKKVYYRDGKCVDENGTLGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKK
2vhlB           YEFGGQSVTVRGRTALLSDGTLAGSILKMNEGARHMREFTNCSWTDIANITSENAAKQLGIFDRKGSVTV
2vhlA           YEFGGQSVTVRGRTALLSDGTLAGSILKMNEGARHMREFTNCSWTDIANITSENAAKQLGIFDRKGSVTV
3iv8D           EMLG-------------------GSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKK
3egjB           FIFVGKKVYYRDGKCVDENGTLGGSALTMIEAVQNTVEHVGIALDEALRMATLYPAKAIGVDEKLGRIKK
2p50A           FIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAA
2p53A           FIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAA
1yrrA           FIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAA
1ymyA           FIFAGKTIYYRNGLCVDENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAA
2p50C           ----------------------AGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAA
2p50D           ------------------TAPASGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAA
2p50B           ---------------------ASGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAA
1yrrB           ---------------------TSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAA
1ymyB           ---------------------TAGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAA
1o12A           TTLGDLVVKVKDGVPRLEDGTLAGSTLFFSQAVKNFRKFTGCSITELAKVSSYNSCVELGLDD-RGRIAE
3griB           HAPHARDEKAQPEKAPF---GIVGSETAFPLLYTHFVKNGDWTLQQLVDYLT---IKPCETFNEYGTLKE
3griA           HAPHARDEKAQPEKAPF---GIVGSETAFPLLYTHFVKNGDWTLQQLVDYLT---IKPCETFNEYGTLKE
1gkrA           ----------------------------------------------------------------------
1xrtB           ----------------------------------------------------------------------
1xrtA           ----------------------------------------------------------------------
1xrfA           ----------------------------------------------------------------------
2fvkD           ----------------------------------------------------------------------
2ftyD           ----------------------------------------------------------------------
2ftyC           ----------------------------------------------------------------------
2ftyA           ----------------------------------------------------------------------
3d6nA           ----------------------------------------------------------------------
1ybqA           -------------EGNLTHIGVAG-FETLLETVQVLVKDYDFSISDALRPLTSSVAGFLNLTG-KGEILP
1gkpA           ----------------------------------------------------------------------
2ftwA           ----------------------------------------------------------------------
1k1dA           -------------------------------------KKGRITLNQFVDIVSTRIAKLFGLFPKKGTIVV
2aqvB           ----------------------------------------------------------------------
2aqvA           ----------------------------------------------------------------------
1ybqB           ----------------------------------------------------------------------
1pokA           ----------------------------------------------------------------------
1pokB           ----------------------------------------------------------------------
1pojA           ----------------------------------------------------------------------
1po9A           ----------------------------------------------------------------------
1onxA           ----------------------------------------------------------------------
1onwB           ----------------------------------------------------------------------
1onwA           ----------------------------------------------------------------------
2aqoB           ----------------------------------------------------------------------
2aqoA           ----------------------------------------------------------------------
2z00A           ----------------------------------------------------------------------
1nfgA           ----------------------------------------------------------------------
3hm7C           ----------------------------------------------------------------------
3hm7B           ----------------------------------------------------------------------
3hm7A           ----------------------------------------------------------------------
3dugC           ----------------------------------------------------------------------
3dugA           ----------------------------------------------------------------------
3be7C           ----------------------------------------------------------------------
3be7B           ----------------------------------------------------------------------
3be7A           ----------------------------------------------------------------------
1p1mA           ----------------------------------------NLDVNTCLKMVTYDGAQ--AMGFKSGKIEE
3e74B           ----------------------------------------------------------------------
3dc8B           ----------------------------------------------------------------------
3dc8A           ----------------------------------------------------------------------
3e74A           ----------------------------------------------------------------------
2r8cF           ----------------------------------------------------------------------
2r8cD           ----------------------------------------------------------------------
2r8cB           ----------------------------------------------------------------------
2r8cA           ----------------------------------------------------------------------
3gnhA           ----------------------------------------------------------------------
3e74C           ----------------------------------------------------------------------
2vr2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GYDADLILFDDNIDIKYVIVNGKLVHKx
3iv8A           GMIANLTVFDRDFNVKATVVNGQ-----
3egjA           GMIANLTVFDRDFNVKATVVNGQ-----
2vhlB           GKDADLVIVSSDCEVILTICRGNI----
2vhlA           GKDADLVIVSSDCEVILTICRGNI----
3iv8D           GMIANLTVFDRDFNVKATVVNGQ-----
3egjB           GMIANLTVFDRDFNVKATVVNGQ-----
2p50A           GKVANLTAFTPDFKITKTIVNGNEV---
2p53A           GKVANLTAFTPDFKITKTIVNGNEV---
1yrrA           GKVANLTAFTPDFKITKTIVNGNEV---
1ymyA           GKVANLTAFTPDFKITKTIVNGNEV---
2p50C           GKVANLTAFTPDFKITKTIVNGNEV---
2p50D           GKVANLTAFTPDFKITKTIVNGNEV---
2p50B           GKVANLTAFTPDFKITKTIVNGNEV---
1yrrB           GKVANLTAFTPDFKITKTIVNGNEV---
1ymyB           GKVANLTAFTPDFKITKTIVNGNEV---
1o12A           G---------------------------
3griB           NGYADLTIID------------------
3griA           NGYADLTIID------------------
1gkrA           ----------------------------
1xrtB           ----------------------------
1xrtA           ----------------------------
1xrfA           ----------------------------
2fvkD           ----------------------------
2ftyD           ----------------------------
2ftyC           ----------------------------
2ftyA           ----------------------------
3d6nA           ----------------------------
1ybqA           GNDADLLVMTPELRIEQVYARGKLMVK-
1gkpA           ----------------------------
2ftwA           ----------------------------
1k1dA           GSDADLVIFDPNIE--------------
2aqvB           ----------------------------
2aqvA           ----------------------------
1ybqB           ----------------------------
1pokA           ----------------------------
1pokB           ----------------------------
1pojA           ----------------------------
1po9A           ----------------------------
1onxA           ----------------------------
1onwB           ----------------------------
1onwA           ----------------------------
2aqoB           ----------------------------
2aqoA           ----------------------------
2z00A           ----------------------------
1nfgA           ----------------------------
3hm7C           ----------------------------
3hm7B           ----------------------------
3hm7A           ----------------------------
3dugC           ----------------------------
3dugA           ----------------------------
3be7C           ----------------------------
3be7B           ----------------------------
3be7A           ----------------------------
1p1mA           GWNADLVVIDLDLPEMFPVQNIKLVH--
3e74B           ----------------------------
3dc8B           ----------------------------
3dc8A           ----------------------------
3e74A           ----------------------------
2r8cF           ----------------------------
2r8cD           ----------------------------
2r8cB           ----------------------------
2r8cA           ----------------------------
3gnhA           ----------------------------
3e74C           ----------------------------
2vr2A           ----------------------------