[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE2216

[Show Plain Result]

#ERROR : Can't open dsspfile "3fb9A.bssp"

## Summary of PDB Search
:78
    3e-05  39%  3fb9A  [x.x.x] UNCHARACTERIZED PROTEIN
:78

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxHVGEKVKLRANGGRKKILENEGILESVHPSIFVVRLQKDTQRKVTYSYSDVLTK
3fb9A           ----------------HEGQVVEMTLENGRKRQKNRLGKLIEVYPSLFIVEVEGDKQVNVSFTYSDILTE


                         .         .         *         .         .         .         .:140
query           xxxxxxxx
3fb9A           --------