[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:thrS

[Show Plain Result]

#ERROR : Can't open dsspfile "1nyrA.bssp"
#ERROR : Can't open dsspfile "1nyqB.bssp"
#ERROR : Can't open dsspfile "1nyrB.bssp"
#ERROR : Can't open dsspfile "1qf6A.bssp"
#ERROR : Can't open dsspfile "1evlA.bssp"
#ERROR : Can't open dsspfile "1tjeA.bssp"
#ERROR : Can't open dsspfile "2i4nB.bssp"
#ERROR : Can't open dsspfile "2i4lB.bssp"
#ERROR : Can't open dsspfile "1nj1A.bssp"
#ERROR : Can't open dsspfile "2i4lA.bssp"
#ERROR : Can't open dsspfile "3ialB.bssp"
#ERROR : Can't open dsspfile "3ialA.bssp"
#ERROR : Can't open dsspfile "2znjB.bssp"
#ERROR : Can't open dsspfile "2znjA.bssp"
#ERROR : Can't open dsspfile "1nj2A.bssp"
#ERROR : Can't open dsspfile "2j3mB.bssp"
#ERROR : Can't open dsspfile "2j3mA.bssp"
#ERROR : Can't open dsspfile "2j3lB.bssp"
#ERROR : Can't open dsspfile "2j3lA.bssp"
#ERROR : Can't open dsspfile "3dsqA.bssp"
#ERROR : Can't open dsspfile "3dsqB.bssp"
#ERROR : Can't open dsspfile "1wwtA.bssp"
#ERROR : Can't open dsspfile "1serB.bssp"
#ERROR : Can't open dsspfile "1serA.bssp"
#ERROR : Can't open dsspfile "3errA.bssp"
#ERROR : Can't open dsspfile "2dq3A.bssp"
#ERROR : Can't open dsspfile "2zt5A.bssp"
#ERROR : Can't open dsspfile "2q5iA.bssp"
#ERROR : Can't open dsspfile "2q5hA.bssp"
#ERROR : Can't open dsspfile "2pmfA.bssp"
#ERROR : Can't open dsspfile "2pmeA.bssp"
#ERROR : Can't open dsspfile "2q7eA.bssp"
#ERROR : Can't open dsspfile "2q7hA.bssp"
#ERROR : Can't open dsspfile "1h4tA.bssp"
#ERROR : Can't open dsspfile "1h4sA.bssp"
#ERROR : Can't open dsspfile "1h4qA.bssp"

## Summary of PDB Search
:643
    e-150  42%  1nyrA  [d.15.10 - d.67.1 - d.104.1 - c.51.1] THREONYL-TRNA
    e-150  42%  1nyqB  [d.15.10 - d.67.1 - d.104.1 - c.51.1] THREONYL-TRNA
    e-146  43%  1nyrB  [d.15.10 - d.67.1 - d.104.1 - c.51.1] THREONYL-TRNA
    e-116  35%  1qf6A  [d.15.10 - d.67.1 - d.104.1 - c.51.1] THREONYL-TRNA
    1e-74  37%  1evlA  [d.104.1 - c.51.1] THREONYL-TRNA SYNTHETASE
    2e-36  34%  1tjeA  [d.15.10 - d.67.1] THREONYL-TRNA SYNTHETASE
    6e-10  25%  2i4nB  [x.x.x] PROLINE-TRNA LIGASE
    6e-10  25%  2i4lB  [x.x.x] PROLINE-TRNA LIGASE
    7e-10  26%  1nj1A  [d.104.1 - c.51.1 - d.68.5] PROLINE-TRNA SYNTHETASE
    1e-09  25%  2i4lA  [x.x.x] PROLINE-TRNA LIGASE
    1e-09  28%  3ialB  [x.x.x] PROLYL-TRNA SYNTHETASE
    1e-09  28%  3ialA  [x.x.x] PROLYL-TRNA SYNTHETASE
    1e-08  32%  2znjB  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    1e-08  32%  2znjA  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    3e-08  26%  1nj2A  [d.104.1 - c.51.1 - d.68.5] PROLINE-TRNA SYNTHETASE
    5e-08  23%  2j3mB  [x.x.x] PROLYL-TRNA SYNTHETASE
    5e-08  23%  2j3mA  [x.x.x] PROLYL-TRNA SYNTHETASE
    5e-08  23%  2j3lB  [x.x.x] PROLYL-TRNA SYNTHETASE
    5e-08  23%  2j3lA  [x.x.x] PROLYL-TRNA SYNTHETASE
    2e-07  31%  3dsqA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    3e-07  33%  3dsqB  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    3e-07  37%  1wwtA  [x.x.x] THREONYL-TRNA SYNTHETASE, CYTOPLASMIC
    2e-06  25%  1serB  [a.2.7 - d.104.1] PROTEIN (SERYL-TRNA SYNTHETASE
    2e-06  25%  1serA  [a.2.7 - d.104.1] PROTEIN (SERYL-TRNA SYNTHETASE
    2e-06  25%  3errA  [x.x.x] FUSION PROTEIN OF MICROTUBULE BINDING DOMAIN FROM
    9e-06  22%  2dq3A  [x.x.x] SERYL-TRNA SYNTHETASE
    4e-05  45%  2zt5A  [x.x.x] GLYCYL-TRNA SYNTHETASE
    4e-05  45%  2q5iA  [x.x.x] GLYCYL-TRNA SYNTHETASE
    4e-05  45%  2q5hA  [x.x.x] GLYCYL-TRNA SYNTHETASE
    4e-05  45%  2pmfA  [x.x.x] GLYCYL-TRNA SYNTHETASE
    4e-05  45%  2pmeA  [x.x.x] GLYCYL-TRNA SYNTHETASE
    9e-05  29%  2q7eA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    1e-04  29%  2q7hA  [x.x.x] PYRROLYSYL-TRNA SYNTHETASE
    6e-04  35%  1h4tA  [d.104.1 - c.51.1 - d.68.5] PROLYL-TRNA SYNTHETASE
    6e-04  35%  1h4sA  [d.104.1 - c.51.1 - d.68.5] PROLYL-TRNA SYNTHETASE
    6e-04  35%  1h4qA  [d.104.1 - c.51.1 - d.68.5] PROLYL-TRNA SYNTHETASE
:643

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xIKITLKDGSIKEVEAGLSIFEIAQSISQGLARNACCGILNGKVEDLRFIVNEDSSLEICTFDSKEGQHA
1nyrA           -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
1nyqB           -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
1nyrB           -INIQFPDGNKKAFDKGTTTEDIAQSISPGLRKKAVAGKFNGQLVDLTKPLETDGSIEIVTPGSEEALEV
1qf6A           ---ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEI
1evlA           ----------------------------------------------------------------------
1tjeA           ---ITLPDGSQRHYDHAVSPMDVALDIGPGLAKACIAGRVNGELVDACDLIENDAQLSIITAKDEEGLEI
2i4nB           ----------------------------------------------------------------------
2i4lB           ----------------------------------------------------------------------
1nj1A           ----------------------------------------------------------------------
2i4lA           ----------------------------------------------------------------------
3ialB           ----------------------------------------------------------------------
3ialA           ----------------------------------------------------------------------
2znjB           ----------------------------------------------------------------------
2znjA           ----------------------------------------------------------------------
1nj2A           ----------------------------------------------------------------------
2j3mB           ----------------------------------------------------------------------
2j3mA           ----------------------------------------------------------------------
2j3lB           ----------------------------------------------------------------------
2j3lA           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
1wwtA           -IKVTLPDGKQVDAESWKTTYQIACGISQGLADNTVIAKVNNVVWDLDRPLEEDCTLELLKFEDEEAQAV
1serB           ----------------------------------------------------------------------
1serA           ----------------------------------------------------------------------
3errA           ----------------------------------------------------------------------
2dq3A           ----------------------------------------------------------------------
2zt5A           ----------------------------------------------------------------------
2q5iA           ----------------------------------------------------------------------
2q5hA           ----------------------------------------------------------------------
2pmfA           ----------------------------------------------------------------------
2pmeA           ----------------------------------------------------------------------
2q7eA           ----------------------------------------------------------------------
2q7hA           ----------------------------------------------------------------------
1h4tA           ----------------------------------------------------------------------
1h4sA           ----------------------------------------------------------------------
1h4qA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FNHTASHVLAAAVKRLFPQDKLAIGPSIDNGFYYDFDTEKPFSADQLNXXXXXXXXXXXXXXXXXRFELP
1nyrA           LRHSTAHLMAHAIKRLYGNVKFGVGPVIEGGFYYDFDIDQNISSDDFEQIEKTMKQIVNENMKIERKVVS
1nyqB           LRHSTAHLMAHAIKRLYGNVKFGVGPVIEGGFYYDFDIDQNISSDDFEQIEKTMKQIVNENMKIERKVVS
1nyrB           LRHSTAHLMAHAIKRLYGNVKFGVGPVIEGGFYYDFDIDQNISSDDFEQIEKTMKQIVNENMKIERKVVS
1qf6A           IRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVS
1evlA           ----------------------------------------------------------------------
1tjeA           IRHSCAHLLGHAIKQLWPHTKMAIGPVIDNGFYYDVDLDRTLTQEDVEALEKRMHELAEKNYDVIKKKVS
2i4nB           ----------------------------------------------------------------------
2i4lB           ----------------------------------------------------------------------
1nj1A           ----------------------------------------------------------------------
2i4lA           ----------------------------------------------------------------------
3ialB           ----------------------------------------------------------------------
3ialA           ----------------------------------------------------------------------
2znjB           ----------------------------------------------------------------------
2znjA           ----------------------------------------------------------------------
1nj2A           ----------------------------------------------------------------------
2j3mB           ----------------------------------------------------------------------
2j3mA           ----------------------------------------------------------------------
2j3lB           ----------------------------------------------------------------------
2j3lA           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
1wwtA           YSGPSS----------------------------------------------------------------
1serB           ----------------------------------------------------------------------
1serA           ----------------------------------------------------------------------
3errA           ----------------------------------------------------------------------
2dq3A           ----------------------------------------------------------------------
2zt5A           ----------------------------------------------------------------------
2q5iA           ----------------------------------------------------------------------
2q5hA           ----------------------------------------------------------------------
2pmfA           ----------------------------------------------------------------------
2pmeA           ----------------------------------------------------------------------
2q7eA           ----------------------------------------------------------------------
2q7hA           ----------------------------------------------------------------------
1h4tA           ----------------------------------------------------------------------
1h4sA           ----------------------------------------------------------------------
1h4qA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RNEALELMKDEPYKVELINDLPEGEVISFYQIGDFVDLCAGPHLMAVKPIKAVKLLRSTGAYWKGDEKNK
1nyrA           RDEAKELFSNDEYKLELIDAIPEDENVTLYSQGDFTDLCRGVHVPSTAKIKEFKLLSTAGAYWRGDSNNK
1nyqB           RDEAKELFSNDEYKLELIDAIPEDENVTLYSQGDFTDLCRGVHVPSTAKIKEFKLLSTAGAYWRGDSNNK
1nyrB           RDEAKEL--------ELIDAIPEDENVTLYSQGDFTDLCRGVHVPSTAKIKEFKLLSTAGAYWRGDSNNK
1qf6A           WHEARETFRGESYKVSILDEIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNK
1evlA           ----------------------------------------------------------------------
1tjeA           WHEARETFRGESYKVSILDEIAHDDKPGLYFHEEYVDMCRGPHVPNMRFCHHFKLMKTAGAYWRGDSNNK
2i4nB           ----------------------------------------------------------------------
2i4lB           ----------------------------------------------------------------------
1nj1A           ----------------------------------------------------------------------
2i4lA           ----------------------------------------------------------------------
3ialB           ----------------------------------------------------------------------
3ialA           ----------------------------------------------------------------------
2znjB           ----------------------------------------------------------------------
2znjA           ----------------------------------------------------------------------
1nj2A           ----------------------------------------------------------------------
2j3mB           ----------------------------------------------------------------------
2j3mA           ----------------------------------------------------------------------
2j3lB           ----------------------------------------------------------------------
2j3lA           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
1wwtA           ----------------------------------------------------------------------
1serB           ----------------------------------------------------------------------
1serA           ----------------------------------------------------------------------
3errA           ----------------------------------------------------------------------
2dq3A           ----------------------------------------------------------------------
2zt5A           ----------------------------------------------------------------------
2q5iA           ----------------------------------------------------------------------
2q5hA           ----------------------------------------------------------------------
2pmfA           ----------------------------------------------------------------------
2pmeA           ----------------------------------------------------------------------
2q7eA           ----------------------------------------------------------------------
2q7hA           ----------------------------------------------------------------------
1h4tA           ----------------------------------------------------------------------
1h4sA           ----------------------------------------------------------------------
1h4qA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MLSRVYGTAFPKKSXXXXXXXXXXXXKKRDHNKLGRELGIFTTDENVGQGLPLLMPKGARIIQTLQRWIE
1nyrA           MLQRIYGTAFFDKKELKAHLQMLEERKERDHRKIGKELELFTNSQLVGAGLPLWLPNGATIRREIERYIV
1nyqB           MLQRIYGTAFFDKKELKAHLQMLEERKERDHRKIGKELELFTNSQLVGAGLPLWLPNGATIRREIERYIV
1nyrB           MLQRIYGTAFFDKKELKAHLQMLEERKERDHRKIGKELELFTNSQLVGAGLPLWLPNGATIRREIERYIV
1qf6A           MLQRIYGTAWADKKALNAYLQRLEEAAKRDHRKIGKQLDLYHMQEEA-PGMVFWHNDGWTIFRELEVFVR
1evlA           ----------------------------RDHRKIGKQLDLYHMQEEA-PGMVFWHNDGWTIFRELEVFVR
1tjeA           MLQRIYGTAW------------------------------------------------------------
2i4nB           -------------------------------------------------GIYAWLPLGHRVLKKIEQIVR
2i4lB           -------------------------------------------------GIYAWLPLGHRVLKKIEQIVR
1nj1A           ------------------------------------------------KGMHVWMPHGFMILKILRRILD
2i4lA           -------------------------------------------------GIYAWLPLGHRVLKKIEQIVR
3ialB           ------------------------------------------------KGCVVFRPYGFFMENAIMRLCE
3ialA           ------------------------------------------------KGCVVFRPYGFFMENAIMRLCE
2znjB           ----------------------------------------------------------------------
2znjA           ----------------------------------------------------------------------
1nj2A           ----------------------------------------------------------------------
2j3mB           ----------------------------------------------VAAGIYSYLPLANRVLEKLKTIMR
2j3mA           ----------------------------------------------VAAGIYSYLPLANRVLEKLKTIMR
2j3lB           ----------------------------------------------VAAGIYSYLPLANRVLEKLKTIMR
2j3lA           ----------------------------------------------VAAGIYSYLPLANRVLEKLKTIMR
3dsqA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
1wwtA           ----------------------------------------------------------------------
1serB           ----------------------------------------------------------------LLRFAM
1serA           ----------------------------------------------------------------LLRFAM
3errA           ----------------------------------------------------------------LLRFAM
2dq3A           ----------------------------KPHWEIGERLGILDFKRGAGSRFTVIAGWGARLERALINFL-
2zt5A           ----------------------------------------------------------------------
2q5iA           ----------------------------------------------------------------------
2q5hA           ----------------------------------------------------------------------
2pmfA           ----------------------------------------------------------------------
2pmeA           ----------------------------------------------------------------------
2q7eA           ----------------------------------------------------------------------
2q7hA           ----------------------------------------------------------------------
1h4tA           ----------------------------------------------------------------------
1h4sA           ----------------------------------------------------------------------
1h4qA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DEEQRRGYVLTKTPLMAKSDLYKISGHWDHYKDGMFVLGDEEKDSEVFALRPMTCPFQYAIYNSTQHSYR
1nyrA           DKEVSMGYDHVYTPVLANVDLYKTSGHWDHYQEDMFP-PMQLDETESMVLRPMNCPHHMMIYANKPHSYR
1nyqB           DKEVSMGYDHVYTPVLANVDLYKTSGHWDHYQEDMFP-PMQLDETESMVLRPMNCPHHMMIYANKPHSYR
1nyrB           DKEVSMGYDHVYTPVLANVDLYKTSGHWDHYQEDMFP-PMQLDETESMVLRPMNCPHHMMIYANKPHSYR
1qf6A           SKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENRE---YCIKPMNCPGHVQIFNQGLKSYR
1evlA           SKLKEYQYQEVKGPFMMDRVLWEKTGHWDNYKDAMFTTSSENRE---YCIKPMNCPGHVQIFNQGLKSYR
1tjeA           ----------------------------------------------------------------------
2i4nB           EEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADRHKRELLYG--PTNEEMITEIFRAYIKSYK
2i4lB           EEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADRHKRELLYG--PTNEEMITEIFRAYIKSYK
1nj1A           RDHEEVLFPL----LVPEDELAKEAIHVKGFEDEVYWVGGLSKLQRKLALRPTSETVMYPMFALWVRSHT
2i4lA           EEQNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADRHKRELLYG--PTNEEMITEIFRAYIKSYK
3ialB           EEYAKVGISQILFPVIPESFLKKESDHIKGFEAECFWVGGLQPLEERLALRPTSETAIYSMFSKWVRSYK
3ialA           EEYAKVGISQILFPVIPESFLKKESDHIKGFEAECFWVGGLQPLEERLALRPTSETAIYSMFSKWVRSYK
2znjB           ----QQGFVQVVTPIITKSALAKMTIGEDHPLFSQVFWLDGKK-----CLRPMLAPNLYTLWRELERLW-
2znjA           ----QQGFVQVVTPIITKSALAKMTIGEDHPLFSQVFWLDGKK-----CLRPMLAPNLYTLWRELERLW-
1nj2A           --------------------------------------GGLSKLQRKLALRPTSETVMYPMFALWVRSHT
2j3mB           EEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKD--RNDRDYILGPTHEETFTELIRDEINSYK
2j3mA           EEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKD--RNDRDYILGPTHEETFTELIRDEINSYK
2j3lB           EEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKD--RNDRDYILGPTHEETFTELIRDEINSYK
2j3lA           EEFEKIDAVEMLMPALLPAELWKESGRYETYGPNLYRLKD--RNDRDYILGPTHEETFTELIRDEINSYK
3dsqA           ----QQGFVQVVTPIITKSALAKMTIGEPLFSQVFWLDGKK-------CLRPMLAPNLYTLWRELERLW-
3dsqB           ----QQGFVQVVTPIITKSALAKMT----HPLFSQVFWLDGKK-----CLRPMLAPNLYTLWRELERLW-
1wwtA           ----------------------------------------------------------------------
1serB           DFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETD-----LYLTGTAEVVLNALHSGEILPYE
1serA           DFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETD-----LYLTGTAEVVLNALHSGEILPYE
3errA           DFMARRGFLPMTLPSYAREKAFLGTGHFPAYRDQVWAIAETD-----LYLTGTAEVVLNALHSGEILPYE
2dq3A           DLHTKKGYKEICPPHLVKPEILIGTGQLPKFEEDLYKC---ERDN-LYLIPTAEVPLTN-LYREEILKEE
2zt5A           ----------------------------------------------------------------------
2q5iA           ----------------------------------------------------------------------
2q5hA           ----------------------------------------------------------------------
2pmfA           ----------------------------------------------------------------------
2pmeA           ----------------------------------------------------------------------
2q7eA           -----RGFLEIKSPILIPLEYIERMGI-DNLSKQIF------RVDKNFCLRPMLAPNLYNYLRKLDRALP
2q7hA           -----RGFLEIKSPILIPLEYIERMGI-DELSKQIF------RVDKNFCLRPMLAPNLYNYLRKLDRALP
1h4tA           ----------------------------------------------------------------------
1h4sA           ----------------------------------------------------------------------
1h4qA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DLPVRFAETSTLFRNESSGEMHGLIRVRQFTLADGHIVCTPEQLEDEFKNTVDLVKYVMETLGIADDITY
1nyrA           ELPIRIAELGTMHRYEASGAVSGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIIDVYKDFGF-EDYSF
1nyqB           ELPIRIAELGTMHRYEASGAVSGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIIDVYKDFGF-EDYSF
1nyrB           ELPIRIAELGTMHRYEASGAVSGLQRVRGMTLNDSHIFVRPDQIKEEFKRVVNMIIDVYKDFGF-EDYSF
1qf6A           DLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGF-EKIVV
1evlA           DLPLRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEEQIRDEVNGCIRLVYDMYSTFGF-EKIVV
1tjeA           ----------------------------------------------------------------------
2i4nB           SLPLNLYHIQWKFRDEQRPRF-GVMRGREFLMKDAYSFDVDEAGARKSYNKM-FVAYLAETGPIGGDLSH
2i4lB           SLPLNLYHIQWKFRDEQRPRF-GVMRGREFLMKDAYSFDVDEAGARKSYNKM-FVAYLAETGPIGGDLSH
1nj1A           DLPMRFYQVVNTFRYETK-HTRPLIRVREITFKEAHTIATASEAEEQVERAVEIYKEFFNSLGIPYLITR
2i4lA           SLPLNLYHIQWKFRDEQRPRF-GVMRGREFLMKDAYSFDVDEAGARKSYNKM-FVAYLAETGPIGGDLSH
3ialB           DLPLKIHQTCTIFRHETK-NTKPLIRVREIHWNEAH--CCHATAEDAVSQLSDYWK-VIDTI-FSDELCF
3ialA           DLPLKIHQTCTIFRHETK-NTKPLIRVREIHWNEAH--CCHATAEDAVSQLSDYWK-VIDTI-FSDELCF
2znjB           DKPIRIFEIGTCYRKESQGAQH----LNEFTMLNLTELGTP--LEERHQRLEDMARWVLEAAGIRE----
2znjA           DKPIRIFEIGTCYRKESQGAQH----LNEFTMLNLTELGTP--LEERHQRLEDMARWVLEAAGIRE----
1nj2A           DLPMRFYQVVNTFRYETK-HTRPLIRVREITFKEAHTIATASEAEEQVERAVEIYKEFFNSLGIPYLITR
2j3mB           RLPLNLYQIQTKYRDEKRSRS-GLLRGREFIMKDGYSFHADESLDQSYRDYEKAYSRIFERCGL------
2j3mA           RLPLNLYQIQTKYRDEKRSRS-GLLRGREFIMKDGYSFHADESLDQSYRDYEKAYSRIFERCGL------
2j3lB           RLPLNLYQIQTKYRDEKRSRS-GLLRGREFIMKDGYSFHADESLDQSYRDYEKAYSRIFERCGL------
2j3lA           RLPLNLYQIQTKYRDEKRSRS-GLLRGREFIMKDGYSFHADESLDQSYRDYEKAYSRIFERCGL------
3dsqA           DKPIRIFEIGTCYRKESQGAQH----LNEFTMLNLTELGTP--LEERHQRLEDMARWVLEAAGIRE----
3dsqB           DKPIRIFEIGTCYRKESQGAQH----LNEFTMLNLTELGTP--LEERHQRLEDMARWVLEAAGIRE----
1wwtA           ----------------------------------------------------------------------
1serB           ALPLRYAGYAPAFRSEAGSDVRGLMRVHQFHKVEQYVL-TEASLEASDRAFQELLENAEEILRLL-ELPY
1serA           ALPLRYAGYAPAFRSEAGSDVRGLMRVHQFHKVEQYVL-TEASLEASDRAFQELLENAEEILRLL-ELPY
3errA           ALPLRYAGYAPAFRSEAGSDVRGLMRVHQFHKVEQYVL-TEASLEASDRAFQELLENAEEILRLL-ELPY
2dq3A           NLPIYLTAYTPCYRREAGADIRGIIRQHQFDKVELVKIVHPDTSYDELEKLVKDAEEVLQLLGLPYRVV-
2zt5A           -LPFAAAQIGNSFRNEISPRS-GLIRVREFTMAEEHFVDPSEKDHPKFQNVADLHLYL------------
2q5iA           -LPFAAAQIGNSFRNEISPRS-GLIRVREFTMAEEHFVDPSEKDHPKFQNVADLHLYL------------
2q5hA           -LPFAAAQIGNSFRNEISPRS-GLIRVREFTMAEEHFVDPSEKDHPKFQNVADLHLYL------------
2pmfA           -LPFAAAQIGNSFRNEISPRS-GLIRVREFTMAEEHFVDPSEKDHPKFQNVADLHLYL------------
2pmeA           -LPFAAAQIGNSFRNEISPRS-GLIRVREFTMAEEHFVDPSEKDHPKFQNVADLHLYL------------
2q7eA           D-PIKIFEIGPCYRKESDGKEH----LEEFTMLN------------------------------------
2q7hA           D-PIKIFEIGPCYRKESDGKEH----LEEFTMLN------------------------------------
1h4tA           ----------------------------------------------------------------------
1h4sA           ----------------------------------------------------------------------
1h4qA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RFSKWDPNNTEKYINDPEAWENTQNIMREILNHLNIDFTEADDEAAFYGPKLDIQFKNVHGKEDTIITIQ
1nyrA           RLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTAQ
1nyqB           RLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTAQ
1nyrB           RLSYRDPEDKEKYFDDDDMWNKAENMLKEAADELGLSYEEAIGEAAFYGPKLDVQVKTAMGKEETLSTAQ
1qf6A           KLS----TRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQ
1evlA           KLS----TRPEKRIGSDEMWDRAEADLAVALEENNIPFEYQLGEGAFYGPKIEFTLYDCLDRAWQCGTVQ
1tjeA           ----------------------------------------------------------------------
2i4nB           EF-----------IVLAETGESGVYIDRDVLNDENVDYDGIKQWTSVYAATEDVRYESEVPEANRLNTRG
2i4lB           EF-----------IVLAETGESGVYIDRDVLNDENVDYDGIKQWTSVYAATEDVRYESEVPEANRLNTRG
1nj1A           R-PPWDKFPGSEY-------------------------TVAFDTLMPDGKTL--QIGTVHNLGQT-----
2i4lA           EF-----------IVLAETGESGVYIDRDVLNDENVDYDGIKQWTSVYAATEDVRYESEVPEANRLNTRG
3ialB           KGQKWD-------------------------RFPGADYSEVSDVVMPCGRVL--QTAGIH---------N
3ialA           KGQKWD-------------------------RFPGADYSEVSDVVMPCGRVL--QTAGIH---------N
2znjB           ----------------------------------------------------------------------
2znjA           ----------------------------------------------------------------------
1nj2A           R-PPWDKFPGSEY-------------------------TVAFDTLMPDGKTL--QIGTVHNLGQT-----
2j3mB           ----------------------------------------------------------------------
2j3mA           ----------------------------------------------------------------------
2j3lB           ----------------------------------------------------------------------
2j3lA           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
1wwtA           ----------------------------------------------------------------------
1serB           RLGKWRQVDIEVYLPSEGRYRETHS---------------------------------------------
1serA           RLGKWRQVDIEVYLPSEGRYRETHS---------------------------------------------
3errA           RLGKWRQVDIEVYLPSEGRYRETHS---------------------------------------------
2dq3A           ELCTGDLGFSAAKTYDIEVWFPSQNKYREISSCSNCEDFQARRNTRFKDSK-------------------
2zt5A           ----------------------------------------------------------------------
2q5iA           ----------------------------------------------------------------------
2q5hA           ----------------------------------------------------------------------
2pmfA           ----------------------------------------------------------------------
2pmeA           ----------------------------------------------------------------------
2q7eA           -FCQMGSGCTR---------ENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIP
2q7hA           -FCQMGSGCTR---------ENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIP
1h4tA           ----------------------------------------------------------------------
1h4sA           ----------------------------------------------------------------------
1h4qA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           IDFALAERFGMYYIDKDGEKKRPYIIHRSSIGCYERTLAMLIEKYAGALPTWIAPVQAKVLPLSDKYADY
1nyrA           LDFLLPERFDLTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEETKGAFPTWLAPKQVQIIPVNDLHYDY
1nyqB           LDFLLPERFDLTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEETKGAFPTWLAPKQVQIIPVNDLHYDY
1nyrB           LDFLLPERFDLTYIGQDGEHHRPVVIHRGVVSTMERFVAFLTEETKGAFPTWLAPKQVQIIPVNDLHYDY
1qf6A           LDFSLPSRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAGFFPTWLAPVQVVIMNITDSQSEY
1evlA           LDFSLPSRLSASYVGEDNERKVPVMIHRAILGSMERFIGILTEEFAGFFPTWLAPVQVVIMNITDSQSEY
1tjeA           ----------------------------------------------------------------------
2i4nB           IEVGQIFYFGTKYSDSTGPDGTDAPIHGGSYGVVSRLLGAIIEACHDIWPEAVAPFRVTILNLGDAATDA
2i4lB           IEVGQIFYFGTKYSDSTGPDGTDAPIHGGSYGVVSRLLGAIIEACHDIWPEAVAPFRVTILNLGDAATDA
1nj1A           ----FARTFEIKFETPEGDHE---YVHQTCYGLSDRVIASVIDESGLCLPPDVAAHQVVIVPIAEEVMEA
2i4lA           IEVGQIFYFGTKYSDSTGPDGTDAPIHGGSYGVVSRLLGAIIEACHDIWPEAVAPFRVTILNLGDAATDA
3ialB           LGQRFSSTFDILYANKANESVHPYL---TCAGISTRVLACALSIHGDSLPPLIAPIHVVIIPI-------
3ialA           LGQRFSSTFDILYANKANESVHPYL---TCAGISTRVLACALSIHGDSLPPLIAPIHVVIIPI-------
2znjB           ----------------------------------------------------------------------
2znjA           ----------------------------------------------------------------------
1nj2A           ----FARTFEIKFETPEGDHE---YVHQTCYGLSDRVIASVIDESGLCLPPDVAAHQVVIVPIAEEVMEA
2j3mB           ----------------------------------------------------------------------
2j3mA           ----------------------------------------------------------------------
2j3lB           ----------------------------------------------------------------------
2j3lA           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
1wwtA           ----------------------------------------------------------------------
1serB           ----------------------------------------------------------------------
1serA           ----------------------------------------------------------------------
3errA           ----------------------------------------------------------------------
2dq3A           ----------------------------------------------------------------------
2zt5A           ----------------------------------------------------------------------
2q5iA           ----------------------------------------------------------------------
2q5hA           ----------------------------------------------------------------------
2pmfA           ----------------------------------------------------------------------
2pmeA           ----------------------------------------------------------------------
2q7eA           LD--------------------------------------------------------------------
2q7hA           LD--------------------------------------------------------------------
1h4tA           -----ARAFDIKFQDRDLQVK---YVHTTSWGLSWRFIGAIIMTHGDVLPPRLAPIQVVIVPIRERVLEX
1h4sA           -----ARAFDIKFQDRDLQVK---YVHTTSWGLSWRFIGAIIMTHGDVLPPRLAPIQVVIVPIRERVLEX
1h4qA           -----ARAFDIKFQDRDLQVK---YVHTTSWGLSWRFIGAIIMTHGDVLPPRLAPIQVVIVPIRERVLEX


                         .         .         .         *         .         .         .:630
query           ANXXXXXXXXXXXXXXADHRAEKIGYKIREARLERTPYILVVGEKEAENKEVSVRSRKNGEEGAMPLADF
1nyrA           ARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEF
1nyqB           ARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEF
1nyrB           ARQLQDELKSQGVRVSIDDRNEKMGYKIREAQMQKIPYQIVVGDKEVENNQVNVRQYGSQDQETVEKDEF
1qf6A           VNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEV
1evlA           VNELTQKLSNAGIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEV
1tjeA           ----------------------------------------------------------------------
2i4nB           ADQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADV
2i4lB           ADQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADV
1nj1A           CRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEK--------
2i4lA           ADQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELKRRSDGARENLALADV
3ialB           ----------------------------------------------------------------------
3ialA           ----------------------------------------------------------------------
2znjB           ----------------------------------------------------------------------
2znjA           ----------------------------------------------------------------------
1nj2A           CRELRSRLEAAGFRVHLDDRDIRAGRKYYEWEMRGVPLRVEIGPRDLEKGAAVISRRDTGEK--------
2j3mB           ----------------------------------------------------------------------
2j3mA           ----------------------------------------------------------------------
2j3lB           ----------------------------------------------------------------------
2j3lA           ----------------------------------------------------------------------
3dsqA           ----------------------------------------------------------------------
3dsqB           ----------------------------------------------------------------------
1wwtA           ----------------------------------------------------------------------
1serB           ----------------------------------------------------------------------
1serA           ----------------------------------------------------------------------
3errA           ----------------------------------------------------------------------
2dq3A           ----------------------------------------------------------------------
2zt5A           ----------------------------------------------------------------------
2q5iA           ----------------------------------------------------------------------
2q5hA           ----------------------------------------------------------------------
2pmfA           ----------------------------------------------------------------------
2pmeA           ----------------------------------------------------------------------
2q7eA           ----------------------------------------------------------------------
2q7hA           ----------------------------------------------------------------------
1h4tA           XXXXXXXXXXXXXXVHLDDRDQHTGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE--------
1h4sA           XXXXXXXXXXXXXXVHLDDRDQHTGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE--------
1h4qA           XXXXXXXXXXXXXXVHLDDRDQHTGYKFHEWELKGVPFRVELGPKDLEGGQAVLASRLGGKE--------


                         .         +         .         .         .         .         *:700
query           VNRIVLEIANRxx
1nyrA           IWNLVDEI-----
1nyqB           IWNLVDEI-----
1nyrB           IWNLVDEI-----
1qf6A           IEKLQQEIRSR--
1evlA           IEKLQQEIRSR--
1tjeA           -------------
2i4nB           VARL---------
2i4lB           VARL---------
1nj1A           -------------
2i4lA           VAR----------
3ialB           -------------
3ialA           -------------
2znjB           -------------
2znjA           -------------
1nj2A           -------------
2j3mB           -------------
2j3mA           -------------
2j3lB           -------------
2j3lA           -------------
3dsqA           -------------
3dsqB           -------------
1wwtA           -------------
1serB           -------------
1serA           -------------
3errA           -------------
2dq3A           -------------
2zt5A           -------------
2q5iA           -------------
2q5hA           -------------
2pmfA           -------------
2pmeA           -------------
2q7eA           -------------
2q7hA           -------------
1h4tA           -------------
1h4sA           -------------
1h4qA           -------------