[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE2334

[Show Plain Result]

#ERROR : Can't open dsspfile "3g1cA.bssp"
#ERROR : Can't open dsspfile "3frwF.bssp"
#ERROR : Can't open dsspfile "3frwE.bssp"
#ERROR : Can't open dsspfile "3frwB.bssp"
#ERROR : Can't open dsspfile "3frwD.bssp"
#ERROR : Can't open dsspfile "3frwA.bssp"
#ERROR : Can't open dsspfile "3frwG.bssp"
#ERROR : Can't open dsspfile "3frwC.bssp"

## Summary of PDB Search
:99
    1e-29  62%  3g1cA  [x.x.x] THE TRPR LIKE PROTEIN FROM EUBACTERIUM ELIGENS
    7e-26  63%  3frwF  [x.x.x] PUTATIVE TRP REPRESSOR PROTEIN
    7e-26  63%  3frwE  [x.x.x] PUTATIVE TRP REPRESSOR PROTEIN
    7e-26  63%  3frwB  [x.x.x] PUTATIVE TRP REPRESSOR PROTEIN
    3e-25  63%  3frwD  [x.x.x] PUTATIVE TRP REPRESSOR PROTEIN
    3e-25  63%  3frwA  [x.x.x] PUTATIVE TRP REPRESSOR PROTEIN
    5e-25  65%  3frwG  [x.x.x] PUTATIVE TRP REPRESSOR PROTEIN
    5e-25  65%  3frwC  [x.x.x] PUTATIVE TRP REPRESSOR PROTEIN
:99

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxSKLKGKDLDFLFEAILKLEDINECYNFFEDICTISELKALAQRLHVAKMLREKKTYTEIAEETKA
3g1cA           -----NKLKTQAVEQLFQAILSLKDLDEAYDFFEDVCTINEILSLSQRFEVAKMLREHRTYLDIAEKTGA
3frwF           ------KIRTEEVDHLFEAILCLKNKEECYTFFEDVCTINELLSLSQRFEVAK-LTDKRTYLDISEKTGA
3frwE           ------KIRTEEVDHLFEAILCLKNKEECYTFFEDVCTINELLSLSQRFEVAK-LTDKRTYLDISEKTGA
3frwB           ------KIRTEEVDHLFEAILCLKNKEECYTFFEDVCTINELLSLSQRFEVAK-LTDKRTYLDISEKTGA
3frwD           -------IRTEEVDHLFEAILCLKNKEECYTFFEDVCTINELLSLSQRFEVAK-LTDKRTYLDISEKTGA
3frwA           -------IRTEEVDHLFEAILCLKNKEECYTFFEDVCTINELLSLSQRFEVAK-LTDKRTYLDISEKTGA
3frwG           ----------EEVDHLFEAILCLKNKEECYTFFEDVCTINELLSLSQRFEVAK-LTDKRTYLDISEKTGA
3frwC           ----------EEVDHLFEAILCLKNKEECYTFFEDVCTINELLSLSQRFEVAK-LTDKRTYLDISEKTGA


                         .         .         *         .         .         .         .:140
query           STATISRVNRCLNYGADGYNNILNRLxxx
3g1cA           STATISRVNRSLNYGNDGYDRVFERL---
3frwF           STATISRVNRSLNYGNDGY----------
3frwE           STATISRVNRSLNYGNDGY----------
3frwB           STATISRVNRSLNYGNDGY----------
3frwD           STATISRVNRSLNYGNDGY----------
3frwA           STATISRVNRSLNYGNDGY----------
3frwG           STATISRVNRSLNYGNDGY----------
3frwC           STATISRVNRSLNYGNDGY----------