[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for cper0:CPE2627

[Show Plain Result]

#ERROR : Can't open dsspfile "2p19C.bssp"
#ERROR : Can't open dsspfile "2p19A.bssp"
#ERROR : Can't open dsspfile "2p19B.bssp"
#ERROR : Can't open dsspfile "3bwgB.bssp"
#ERROR : Can't open dsspfile "2ikkB.bssp"
#ERROR : Can't open dsspfile "2ikkA.bssp"
#ERROR : Can't open dsspfile "3bwgC.bssp"
#ERROR : Can't open dsspfile "2ra5A.bssp"
#ERROR : Can't open dsspfile "3ddvD.bssp"
#ERROR : Can't open dsspfile "3ddvB.bssp"
#ERROR : Can't open dsspfile "3edpB.bssp"
#ERROR : Can't open dsspfile "3bwgA.bssp"
#ERROR : Can't open dsspfile "3edpA.bssp"
#ERROR : Can't open dsspfile "3ddvA.bssp"
#ERROR : Can't open dsspfile "3by6E.bssp"
#ERROR : Can't open dsspfile "3by6D.bssp"
#ERROR : Can't open dsspfile "3by6C.bssp"
#ERROR : Can't open dsspfile "3by6B.bssp"
#ERROR : Can't open dsspfile "3by6A.bssp"
#ERROR : Can't open dsspfile "3ddvC.bssp"
#ERROR : Can't open dsspfile "2di3B.bssp"
#ERROR : Can't open dsspfile "2di3A.bssp"
#ERROR : Can't open dsspfile "1hw2A.bssp"
#ERROR : Can't open dsspfile "1hw1A.bssp"
#ERROR : Can't open dsspfile "1h9tA.bssp"
#ERROR : Can't open dsspfile "1h9gA.bssp"
#ERROR : Can't open dsspfile "1e2xA.bssp"
#ERROR : Can't open dsspfile "3ic7B.bssp"
#ERROR : Can't open dsspfile "2ek5C.bssp"
#ERROR : Can't open dsspfile "2ek5A.bssp"
#ERROR : Can't open dsspfile "2du9A.bssp"
#ERROR : Can't open dsspfile "1v4rA.bssp"
#ERROR : Can't open dsspfile "2fa1A.bssp"

## Summary of PDB Search
:241
    1e-11  30%  2p19C  [x.x.x] TRANSCRIPTIONAL REGULATOR
    2e-11  31%  2p19A  [x.x.x] TRANSCRIPTIONAL REGULATOR
    3e-11  31%  2p19B  [x.x.x] TRANSCRIPTIONAL REGULATOR
    8e-10  27%  3bwgB  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    2e-09  27%  2ikkB  [x.x.x] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR YURK
    2e-09  27%  2ikkA  [x.x.x] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR YURK
    2e-09  29%  3bwgC  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    1e-08  28%  2ra5A  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    2e-08  22%  3ddvD  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    2e-08  22%  3ddvB  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    3e-08  33%  3edpB  [x.x.x] LIN2111 PROTEIN
    3e-08  28%  3bwgA  [x.x.x] UNCHARACTERIZED HTH-TYPE TRANSCRIPTIONAL
    3e-08  33%  3edpA  [x.x.x] LIN2111 PROTEIN
    2e-07  27%  3ddvA  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    6e-07  35%  3by6E  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    6e-07  35%  3by6D  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    6e-07  35%  3by6C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    6e-07  35%  3by6B  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    6e-07  35%  3by6A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATOR
    1e-06  26%  3ddvC  [x.x.x] TRANSCRIPTIONAL REGULATOR (GNTR FAMILY)
    2e-05  43%  2di3B  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    2e-05  43%  2di3A  [x.x.x] BACTERIAL REGULATORY PROTEINS, GNTR FAMILY
    5e-05  35%  1hw2A  [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN
    5e-05  35%  1hw1A  [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN
    5e-05  35%  1h9tA  [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN
    5e-05  35%  1h9gA  [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN
    5e-05  35%  1e2xA  [a.4.5 - a.78.1] FATTY ACID METABOLISM REGULATOR PROTEIN
    2e-04  35%  3ic7B  [x.x.x] PUTATIVE TRANSCRIPTIONAL REGULATOR
    2e-04  32%  2ek5C  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    2e-04  32%  2ek5A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    2e-04  32%  2du9A  [x.x.x] PREDICTED TRANSCRIPTIONAL REGULATORS
    3e-04  32%  1v4rA  [x.x.x] TRANSCRIPTIONAL REPRESSOR
    9e-04  18%  2fa1A  [x.x.x] PROBABLE TRANSCRIPTIONAL REGULATOR PHNF
:241

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxIALYHQLETELIDLINSGELKENDKLPSERELCEQYNVSRTTARQAIGELERKEYVYKVHGKG
2p19C           ----------------------------------------------------------------------
2p19A           ----------------------------------------------------------------------
2p19B           ----------------------------------------------------------------------
3bwgB           ----------YQQIATEIETYIEEHQLQQGDKLPVLETLA-QFEVSKSTITKSLELLEQKGAIFQVRGSG
2ikkB           ----------------------------------------------------------------------
2ikkA           ----------------------------------------------------------------------
3bwgC           ----------YQQIATEIETYIEEHQLQQGDKLPVLETLA-QFEVSKSTITKSLELLEQKGAIFQVRGSG
2ra5A           ----------------------------------------------------------------------
3ddvD           ----------------------------------------------------------------------
3ddvB           ----------------------------------------------------------------------
3edpB           ---------LFEVIASKIKDSINRDEYKTG---PNETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGVG
3bwgA           ------------QIATEIETYIEEHQLQQGDKLPVLETLA-QFEVSKSTITKSLELLEQKGAIFQVRGSG
3edpA           ---------LFEVIASKIKDSINRDEYKTG---PNETALQEIYSSSRTTIRRAVDLLVEEGLVVRKNGVG
3ddvA           ----------------------------------------------------------------------
3by6E           ---------VYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG
3by6D           ---------VYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG
3by6C           ---------VYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG
3by6B           ---------VYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG
3by6A           ---------VYLQLVDRIKNEVATDVLSANDQLPSVRETALQEKINPNTVAKAYKELEAQKVIRTIPGKG
3ddvC           ----------------------------------------------------------------------
2di3B           ---------------------LRSGRLKIGDHLPSERALSETLGVSRSSLREALRVLEALGTISTATGSG
2di3A           ---------------------LRSGRLKIGDHLPSERALSETLGVSRSSLREALRVLEALGTISTATGSG
1hw2A           --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
1hw1A           --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
1h9tA           --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
1h9gA           --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
1e2xA           --------------EEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLARDGWLTIQHGKP
3ic7B           --------AIYLQIADRICDDILLGQYEEEGRIPSVRE----YAVNANTVR-SYEYLQSQEVIYNKRGIG
2ek5C           -------VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG
2ek5A           -------VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG
2du9A           -------VPLYKQIASLIEDSIVDGTLSIDQRVPSTNELAAFHRINPATARNGLTLLVEAGILYKKRGIG
1v4rA           ----------YADVATHFRTLIKSGELAPGDTLPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRGALG
2fa1A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TFISPKVYKQQLLKFYSFTEEMKKLGKNPSSKILSFDLIRADNKISEKLKVEENSLVYKIVRLRIADEVP
2p19C           ---------------------LKNANLDPKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIP
2p19A           ----------------------KNANLDPKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIP
2p19B           ---------------------------DPKTRVLEHRLLAASSAIAEKLGVSAGDEVLLIRRLRSTGDIP
3bwgB           IF----VRKHKRKGYISLLSNQDLEDFNVTSKVIELDVRKPTPEAAENLNIGDED-IYYVKRVRYINGQT
2ikkB           --------------------------------VLSHDIIPASKPIAEKLQIQPESPVVELKRILYNDDQP
2ikkA           --------------------------------VLSHDIIPASKPIAEKLQIQPESPVVELKRILYNDDQP
3bwgC           IFVRKHKRKGSLLSLEDF---------NVTSKVIELDVRKPTPEAAENLNIGDED-IYYVKRVRYINGQT
2ra5A           --------------------------RRPATKVLVNTVVPATAEIAAALGVAEDSEVHRIERLRLTHGEP
3ddvD           -----------------------------SSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3ddvB           -----------------------------SSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3edpB           LYVQPKLTAQNILETGVLKKDIKDF------------YIRKAGKFYAEIFGKENELVYSI----------
3bwgA           IF----VRKHKRKGYISLLSNQGDF--NVTSKVIELDVRKPTPEAAENLNIGDED-IYYVKRVRYINGQT
3edpA           LYVQPKLTAQNIL----------ETGVKNLKKDIKDFYIRKAGKFYAEIFGKENELVYSI----------
3ddvA           ----------------------------PSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
3by6E           TFIT------------------------------------------------------------------
3by6D           TFIT------------------------------------------------------------------
3by6C           TFIT------------------------------------------------------------------
3by6B           TFIT------------------------------------------------------------------
3by6A           TFIT------------------------------------------------------------------
3ddvC           ----------------------------PSSRTVSYFVAKPSSSEMEKLQLGPEDSILRMERIRFADDIP
2di3B           ----------------------------------------------------------------------
2di3A           ----------------------------------------------------------------------
1hw2A           TKVN------------------------------------------------------------------
1hw1A           TKVN------------------------------------------------------------------
1h9tA           TKVN------------------------------------------------------------------
1h9gA           TKVN------------------------------------------------------------------
1e2xA           TKVN------------------------------------------------------------------
3ic7B           FFVASSLRKEQFLKVGSFFRQLYTLG--------------------------------------------
2ek5C           -FVS------------------------------------------------------------------
2ek5A           -FVS------------------------------------------------------------------
2du9A           -FVS------------------------------------------------------------------
1v4rA           TVV-------------------------------------------------------------------
2fa1A           -----------------FSQNLLDQGSHPTSEKLLSVLRPASGHVADALGITEGENVIHLRTLRRVNGVA


                         +         .         .         .         .         *         .:210
query           MMVECTYLPEYRFIDLKEKMLKEKPMYDIFREVYNVSLTKAKESFKPILISKSDSKLLNVEDGTAAMRIE
2p19C           VAILENYLPP-AFNDVSLDELEKGGLYDALRS-RGVVLKIANQKIGARRAVGEESTLLDIEDGGPLLTVE
2p19A           VAILENYLPP-AFNDVSLDELEKGGLYDALRS-RGVVLKIANQKIGARRAVGEESTLLDIEDGGPLLTVE
2p19B           VAILENYLPP-AFNDVSLDELEKGGLYDALRS-RGVVLKIANQKIGARRAVGEESTLLDIEDGGPLLTVE
3bwgB           LCYEESY---------------------------------------------------------------
2ikkB           LTFEVTHYPLDLFPGI-DTFIADGVSHDILKQQYKVVPTHNTKLLNVVYAQQEESKYLDCDIGDALFEID
2ikkA           LTFEVTHYPLDLFPGI-DTFIADGVSHDILKQQYKVVPTHNTKLLNVVYAQQEESKYLDCDIGDALFEID
3bwgC           LCYEESY---------------------------------------------------------------
2ra5A           AYL-CNYLPP-GLVDLDTGQLEATGLYRL--RAAGITLHSARQSIGARAATSGEAERLG-EDAGAPLLTE
3ddvD           ICFEVASIP-YSLVSQYGKSEITNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVR
3ddvB           ICFEVASIP-YSLVSQYGKSEITNSFYKTLEAKSGHKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVR
3edpB           ----------------------------------------------------------------------
3bwgA           LCYEESY---------------------------------------------------------------
3edpA           ----------------------------------------------------------------------
3ddvA           ICFEVASIP-----------------YSL------VKIGHSNQTISAVQASEQIAEYLEIKRGDAILRVR
3by6E           ----------------------------------------------------------------------
3by6D           ----------------------------------------------------------------------
3by6C           ----------------------------------------------------------------------
3by6B           ----------------------------------------------------------------------
3by6A           ----------------------------------------------------------------------
3ddvC           ICFEVASIP-----------------YSL--------VGHSNQTISAVQASEQIAEYLEIKRGDAILRVR
2di3B           ----------------------------------------------------------------------
2di3A           ----------------------------------------------------------------------
1hw2A           ----------------------------------------------------------------------
1hw1A           ----------------------------------------------------------------------
1h9tA           ----------------------------------------------------------------------
1h9gA           ----------------------------------------------------------------------
1e2xA           ----------------------------------------------------------------------
3ic7B           ----------------------------------------------------------------------
2ek5C           ----------------------------------------------------------------------
2ek5A           ----------------------------------------------------------------------
2du9A           ----------------------------------------------------------------------
1v4rA           ----------------------------------------------------------------------
2fa1A           LCLIDHYFADLTLWPTLQRF-DSGSLHDFLREQTGIALRRSQTRISARRAQAKECQRLEIPNMSPLLCVR


                         .         .         .         +         .         .         .:280
query           RVTFENERVIEYTVSVSRGDKFEYTVVLxxx
2p19C           RVALDNSQVIELGSHCYRPDMYNFETTL---
2p19A           RVALDNSQVIELGSHCYRPDMYNFETTL---
2p19B           RVALDNSQVIELGSHCYRPDMYNFETTL---
3bwgB           -------------------------------
2ikkB           KTAF---------------------------
2ikkA           KTAF---------------------------
3bwgC           -------------------------------
2ra5A           RTTFDDTRAVEFGTHTYRPSRYSF-------
3ddvD           QVSFENGLPFEYVRTQYAGSRFEF-------
3ddvB           QVSFENGLPFEYVRTQYAGSRFEF-------
3edpB           -------------------------------
3bwgA           -------------------------------
3edpA           -------------------------------
3ddvA           QVSFENGLPFEYVRTQYAGSRFEF-------
3by6E           -------------------------------
3by6D           -------------------------------
3by6C           -------------------------------
3by6B           -------------------------------
3by6A           -------------------------------
3ddvC           QVSFENGLPFEYVRTQYAGSRFEF-------
2di3B           -------------------------------
2di3A           -------------------------------
1hw2A           -------------------------------
1hw1A           -------------------------------
1h9tA           -------------------------------
1h9gA           -------------------------------
1e2xA           -------------------------------
3ic7B           -------------------------------
2ek5C           -------------------------------
2ek5A           -------------------------------
2du9A           -------------------------------
1v4rA           -------------------------------
2fa1A           TLNHRDSSPAEYSVSLTRADMIEFTM-----