[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB80017.1

[Show Plain Result]


## Summary of Sequence Search
    1::262
    1::254     2e-56  45%  260 aa  ETFB_CLOTS RecName: Full=Electron transfer flavoprotein subunit
    1::216     4e-51  48%  259 aa  ETFB_CLOAB RecName: Full=Electron transfer flavoprotein subunit
    1::262     1e-45  39%  285 aa  FIXA_RHISN RecName: Full=Protein fixA;
    1::237     1e-45  42%  281 aa  FIXA_AZOVI RecName: Full=Protein fixA;
    1::270     6e-44  40%  270 aa  ETFB_MEGEL RecName: Full=Electron transfer flavoprotein subunit
    1::239     6e-43  39%  281 aa  FIXA_AZOC5 RecName: Full=Protein fixA;
    1::238     2e-40  40%  288 aa  FIXA_BRAJA RecName: Full=Protein fixA;
    1::236     4e-40  40%  279 aa  FIXA_RHILP RecName: Full=Protein fixA;
    1::242     5e-39  36%  292 aa  FIXA_RHIME RecName: Full=Protein fixA;
    4::212     4e-27  32%  266 aa  ETFB_MYCTU RecName: Full=Electron transfer flavoprotein subunit
    4::212     4e-27  32%  266 aa  ETFB_MYCBO RecName: Full=Electron transfer flavoprotein subunit
    4::212     1e-26  33%  266 aa  ETFB_MYCLE RecName: Full=Electron transfer flavoprotein subunit
    1::255     6e-25  32%  256 aa  FIXA_ECOL6 RecName: Full=Protein fixA;
    1::255     6e-25  32%  256 aa  FIXA_ECO45 RecName: Full=Protein fixA;
    1::255     6e-25  32%  256 aa  FIXA_ECO27 RecName: Full=Protein fixA;
    1::187     6e-25  33%  257 aa  ETFB_BACSU RecName: Full=Electron transfer flavoprotein subunit
    1::255     1e-24  32%  256 aa  FIXA_ECOL5 RecName: Full=Protein fixA;
    1::255     1e-24  32%  256 aa  FIXA_ECO81 RecName: Full=Protein fixA;
    1::255     2e-24  31%  256 aa  FIXA_SALTY RecName: Full=Protein fixA;
    1::255     2e-24  31%  256 aa  FIXA_SALTI RecName: Full=Protein fixA;
    1::255     2e-24  31%  256 aa  FIXA_SALPK RecName: Full=Protein fixA;
    1::255     2e-24  31%  256 aa  FIXA_SALPB RecName: Full=Protein fixA;
    1::255     2e-24  31%  256 aa  FIXA_SALPA RecName: Full=Protein fixA;
    1::255     2e-24  31%  256 aa  FIXA_SALNS RecName: Full=Protein fixA;
    1::255     2e-24  31%  256 aa  FIXA_SALA4 RecName: Full=Protein fixA;
    1::255     5e-24  31%  256 aa  FIXA_SALG2 RecName: Full=Protein fixA;
    1::255     5e-24  31%  256 aa  FIXA_SALDC RecName: Full=Protein fixA;
    1::255     9e-23  31%  256 aa  FIXA_ECOSM RecName: Full=Protein fixA;
    1::255     9e-23  31%  256 aa  FIXA_ECO7I RecName: Full=Protein fixA;
    1::255     5e-22  31%  256 aa  FIXA_ECOLI RecName: Full=Protein fixA;
    1::255     5e-22  31%  256 aa  FIXA_ECOLC RecName: Full=Protein fixA;
    1::255     5e-22  31%  256 aa  FIXA_ECOHS RecName: Full=Protein fixA;
    1::255     5e-22  31%  256 aa  FIXA_ECODH RecName: Full=Protein fixA;
    1::255     5e-22  31%  256 aa  FIXA_ECOBW RecName: Full=Protein fixA;
    1::255     5e-22  31%  256 aa  FIXA_ECO57 RecName: Full=Protein fixA;
    1::255     5e-22  31%  256 aa  FIXA_ECO24 RecName: Full=Protein fixA;
    1::232     6e-22  32%  256 aa  FIXA_SHIFL RecName: Full=Protein fixA;
    1::232     6e-22  32%  256 aa  FIXA_SHIF8 RecName: Full=Protein fixA;
    1::232     6e-22  32%  256 aa  FIXA_ECOSE RecName: Full=Protein fixA;
    1::255     6e-22  31%  256 aa  FIXA_ECOLU RecName: Full=Protein fixA;
    1::232     6e-22  32%  256 aa  FIXA_ECO8A RecName: Full=Protein fixA;
    1::232     6e-22  32%  256 aa  FIXA_ECO55 RecName: Full=Protein fixA;
    1::210     1e-21  32%  256 aa  FIXA_ESCF3 RecName: Full=Protein fixA;
    3::203     3e-19  31%  250 aa  ETFB_DICDI RecName: Full=Electron transfer flavoprotein subunit
    1::207     8e-19  31%  249 aa  ETFB_BRAJA RecName: Full=Electron transfer flavoprotein subunit
    1::210     8e-19  32%  251 aa  ETFB_ARATH RecName: Full=Electron transfer flavoprotein subunit
    1::251     2e-18  29%  254 aa  YDIQ_ECOLI RecName: Full=Putative electron transfer flavoprotein
    4::191     4e-18  36%  255 aa  ETFB_BOVIN RecName: Full=Electron transfer flavoprotein subunit
    4::191     1e-17  35%  255 aa  ETFB_RAT RecName: Full=Electron transfer flavoprotein subunit beta;
    7::221     3e-17  26%  261 aa  ETFB_YEAST RecName: Full=Probable electron transfer flavoprotein
    4::191     8e-17  35%  255 aa  ETFB_MOUSE RecName: Full=Electron transfer flavoprotein subunit
    1::203     2e-15  27%  249 aa  ETFB_PSEAE RecName: Full=Electron transfer flavoprotein subunit
    1::217     8e-14  25%  252 aa  ETFB_PARDE RecName: Full=Electron transfer flavoprotein subunit
    1::212     7e-13  26%  253 aa  ETFB_ORYSJ RecName: Full=Electron transfer flavoprotein subunit
    4::191     1e-12  29%  255 aa  ETFB_HUMAN RecName: Full=Electron transfer flavoprotein subunit
    4::191     3e-12  29%  255 aa  ETFB_PONAB RecName: Full=Electron transfer flavoprotein subunit
    4::191     3e-12  29%  255 aa  ETFB_PIG RecName: Full=Electron transfer flavoprotein subunit beta;
    1::262     2e-10  26%  264 aa  ETFB_METME RecName: Full=Electron transfer flavoprotein subunit
    4::212     7e-10  22%  254 aa  ETFB_SCHPO RecName: Full=Probable electron transfer flavoprotein
    1::212     1e-07  23%  253 aa  ETFB_ORYSI RecName: Full=Electron transfer flavoprotein subunit
   24::78      2e-04  38%   90 aa  MINE_BORA1 RecName: Full=Cell division topological specificity
  608::703     3e-04  30%  883 aa  SYA_SILST RecName: Full=Alanyl-tRNA synthetase;       
   54::207     6e-04  23%  259 aa  YGCR_ECOLI RecName: Full=Putative electron transfer flavoprotein
  104::228     6e-04  28%  825 aa  MRD1_ASPFU RecName: Full=Multiple RNA-binding domain-containing
   24::78      0.001  36%   86 aa  MINE_BORPD RecName: Full=Cell division topological specificity
    1::262

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIMVCIKQVPGTSKVEVDEKTGVLKRDGVDSKMNPYDLYALETALRIKEKKGGNIKVISMGPPQAKAVI
ETFB_CLOTS      MNILVLIKQVPDTNEVRIDPVTKTLIREGVPSIINPDDKNALEEAIRIREKVGGKVTVISMGPTQAEVAL
ETFB_CLOAB      MNIVVCLKQVPDTAEVRIDPVKGTLIREGVPSIINPDDKNALEEALVLKDNYGAHVTVISMGPPQAKNAL
FIXA_RHISN      MHIVVCIKQVPDSAQIRVHPVTNTIMRQGVPTIINPYDLFALEQALQVRDHHGGEVTVLTMGPPMAEESL
FIXA_AZOVI      MHSVVCIKQLPDSAQIRVHPVTNTIMRQGVPAIINPYDLFALEEALRLKDKFGGTVTVVTMGPPMAEAAL
ETFB_MEGEL      MEILVCVKQVPDTAEVKIDPVKHTVIRAGVPNIFNPFDQXXXXXXXXXXXXXXXXITLLSMGPDQAKDVL
FIXA_AZOC5      MHIVVCIKQVPDSAQIRVHPVTNTIMRQGVPTIINPYDLFALEAALALRDQHGGEVTVLTMGPPSAEDSL
FIXA_BRAJA      MHNIVCIKQVPDSAQIRVHPVTNTIMRQGVPTIINPYDLFALEAALGLRDRFGGEITVLTMGPPSAEESL
FIXA_RHILP      MHIVICIKQVPDSAQIRVDPVTNTIMRQGVPTIINPYDLFALEERSSC-ASHGGEVTVLTMGPPMAEDAL
FIXA_RHIME      MHLVVCIKQVPDSAQIRVHPVTNTIMRQGVPTIINPHDLAALEEALKLCDTYGGEVTVVTMGPKMAEDAL
ETFB_MYCTU      --IVVLIKQVPDTSERKLTDGDFTLDREAADAVLDEINERAVEEALQIREKEAGSVTVLTAGPERATEAI
ETFB_MYCBO      --IVVLIKQVPDTSERKLTDGDFTLDREAADAVLDEINERAVEEALQIREKEAGSVTVLTAGPERATEAI
ETFB_MYCLE      --IVVLIKQVPDTSERKLTDGDFTLDREAADAVLDEINERAVEEALQIREKEAGSVTVLTAGPERATEAI
FIXA_ECOL6      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECO45      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECO27      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
ETFB_BACSU      MNLFVLMKRTFDTEEKIVIE-TGKIQDDGAEWIINPYDEYAIEEAIQLKEKHGGTITAVTVGGEEAEKEL
FIXA_ECOL5      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAEAQVTALSVG---GKALT
FIXA_ECO81      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAEAQVTALSVG---GKALT
FIXA_SALTY      MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAACQLKQQLGAQVVAMSVG---GKALT
FIXA_SALTI      MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAACQLKQQLGAQVVAMSVG---GKALT
FIXA_SALPK      MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAACQLKQQLGAQVVAMSVG---GKALT
FIXA_SALPB      MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAACQLKQQLGAQVVAMSVG---GKALT
FIXA_SALPA      MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAACQLKQQLGAQVVAMSVG---GKALT
FIXA_SALNS      MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAACQLKQQLGAQVVAMSVG---GKALT
FIXA_SALA4      MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAACQLKQQLGAQVVAMSVG---GKALT
FIXA_SALG2      MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAACQLKQQLGAQVVAMSVG---GKALT
FIXA_SALDC      MKIITCYKCVPDEQDIAINNADGTLDFSKADSKISQYDLNAIEAACQLKQQLGAQVVAMSVG---GKALT
FIXA_ECOSM      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAGQVTALSVG---GKALT
FIXA_ECO7I      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAGQVTALSVG---GKALT
FIXA_ECOLI      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECOLC      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECOHS      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECODH      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECOBW      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECO57      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECO24      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_SHIFL      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_SHIF8      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECOSE      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECOLU      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECO8A      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ECO55      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
FIXA_ESCF3      MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAACQLKQQAAAQVTALSVG---GKALT
ETFB_DICDI      LKILVPIKRVVDYAKIRVKGDKSGVETANVKMSMNPFDEIAVEEAIRIKEKNAKEIIAVSMGPKTSQETI
ETFB_BRAJA      MKVLVPVKRVVDYNKVRVKGDGSGVELANVKMSMNPFDEIAVEEALRLKEGKATEVVVVSIGPAQASETI
ETFB_ARATH      MKILVAVKRVVDYAKIRVKDKTGV-ETQNVKMSMNPFCEIALEEALRIKEAGAKEVIAVSIGPSQCVDTL
YDIQ_ECOLI      MKIITCFKLVPEEQDIVVTPEY-TLNFDNADAKISQFDLNAIEAASQLATDDD-EIAALTVGGSQNSKVR
ETFB_BOVIN      LRALVAVKRVIDFAKIRVKDKTGVVT-DGVKHSMNPFCEIAVEEAVRLKEKKVKEIIAVSCGPAQCQETI
ETFB_RAT        LRALVAVKRVIDFAKIRVKDKSGVVT-DGVKHSMNPFCEIAVEEAVRLKEKKVKEIIAVSCGPPQCQETI
ETFB_YEAST      LRILVPVKRVVDFQKPRVNKTLTGIETSGIKFSINPFDDIAVEEAIRIKEKNKSLVEAVSIGSAKAQDIL
ETFB_MOUSE      LRALVAVKRVIDFAKIRVKDKSGVVT-DGVKHSMNPFCEIAVEEAVRLKEKKVKEIIAVSCGPSQCQETI
ETFB_PSEAE      MKVLVAVKRVVDYNKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGATEIVAVSVGPTAAQEQL
ETFB_PARDE      MKVLVPVKRIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKQAEEIIAVSIGVKQAAETL
ETFB_ORYSJ      MKILVAVKRVVDYAKVRVPDRTGV-ETASVKMSMNPFCEIAVEEALRLRESXXXXXXXXXXGPSQSADTL
ETFB_HUMAN      LRVLVAVKRVIDYAKIRVKDRTGVVT-DGVKHSMNPFEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQETI
ETFB_PONAB      LRALVAVKRVIDYAKIRVKDRTGVVT-DGVKHSMNPFEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQETI
ETFB_PIG        LRALVAVKRVIDFAKIRVKDRTGVVM-DGVKHSMNPFEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQETI
ETFB_METME      MKILVAVKQ---TAALEEDFE---IREDGMDVDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXXL
ETFB_SCHPO      IRILVGVKRLDYMLKPRINATKTAVDLSGQKMSINPFCDIAVEEAIRMKETLKNRIEVVTAGQTSSEPIL
ETFB_ORYSI      MKILVAVKRVVDYAKVRVPDRTGV-ETASVKMSMNPFXXXXXXXXXXXXXXXXXXXXXXXXXPSQSADTL
MINE_BORA1      ----------------------------------------------------------------------
SYA_SILST       -------------SKISAEVNDFIRQNSAVSTRMTPDDARALGAQALFGEKYGEEVRVVSMGAPTGKGAD
YGCR_ECOLI      -------------------------------------------------QRKNGSLTALSMGDERALHWL
MRD1_ASPFU      ----------------------------------------------------------------------
MINE_BORPD      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KEAYSMGADEGTLVSDRKFAGADVLATSYTLSQGVKKCGDFDIILCGKQTTDGDTAQVGPEMAEYLGIPH
ETFB_CLOTS      REALAMGADEAYLLTDRAFAGADTYATAKALSKAIEKF-QYDIVFCGRQAIDGDTAQVGPQIAEQLDIPQ
ETFB_CLOAB      VEALAMGADEAVLLTDRAFGGADTLATSHTIAAGIKKL-KYDIVFAGRQAIDGDTAQVGPEIAEHLGIPQ
FIXA_RHISN      RKALTYGADRAILLTDRHFAGSDTLATSFALSQAIAKIGNSDIVFTGKQTIDGDTAQVGPGIAKRLDLVQ
FIXA_AZOVI      RKCLSFGADDAILVSDRAFAGSDTLATSYALSAVIRKIMEVDLIFTGKQTIDGDTAQVGPGIAKRLDYQL
ETFB_MEGEL      REGLAMGADDAYLLSDRKLGGSDTLATGYALAQAIKKLAQFDIILCGKQAIDGDTAQVGPQIACELGIPQ
FIXA_AZOC5      RKALTFGADRAVLLTDRFFAGSDXXXXXXXXXXXVRKIGETDIVFTGKQTIDGDTAQVGPGIAKRLGLLQ
FIXA_BRAJA      RKALTYGADRAVLLTDRCFAGSDXXXXXXXXXXXIRKIGPANLIFTGKQTIDGDTAQVGPGIAKRLGVTY
FIXA_RHILP      RKALTV-ADRAVLLTERHFAGSDTLATSFALSRAIAKIGEADIVFTAKQTIDGDTAQVGPGIAKRLDLLQ
FIXA_RHIME      RKALTFGAHRAVLLTDRHFAGSDTLATSFALAQAIAEIGETDVVFTGKQTIDGDTAQVGPGIAKRLDLQQ
ETFB_MYCTU      RKALSMGADKAVHLKDDGMHGSDVIQTGWALARALGTIEGTELVIAGNESTDGVGGAVPAIIAEYLGLPQ
ETFB_MYCBO      RKALSMGADKAVHLKDDGMHGSDVIQTGWALARALGTIEGTELVIAGNESTDGVGGAVPAIIAEYLGLPQ
ETFB_MYCLE      RKALSMGADKAVHLKDDGMHGSDVIQTGWALARALGTIEGTELVIAGNESTDGVGGVVPAIIAEYLGLPQ
FIXA_ECOL6      KDVLSRGPDELIVVIDDQFEQALPQQTASVLAAAAQKAG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECO45      KDVLSRGPDELIVVIDDQFEQALPQQTASVLAAAAQKAG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECO27      KDVLSRGPDELIVVIDDQFEQALPQQTASVLAAAAQKAG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
ETFB_BACSU      RTALAMGCDQAVLINEDDLDEPDQYSISQVLYHYMKD-QEFDLILGGNVAIDGGSGQVAPRLAELLDIPC
FIXA_ECOL5      KDVLSRGPDELIVVIDDQFEQALPQQTASVLAAAAQKAG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECO81      KDVLSRGPDELIVVIDDQFEQALPQQTASVLAAAAQKAG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_SALTY      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSG-FDLLICGDGSSDLYAQQVGLLVGEALNIPA
FIXA_SALTI      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSG-FDLLICGDGSSDLYAQQVGLLVGEALNIPA
FIXA_SALPK      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSG-FDLLICGDGSSDLYAQQVGLLVGEALNIPA
FIXA_SALPB      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSG-FDLLICGDGSSDLYAQQVGLLVGEALNIPA
FIXA_SALPA      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSG-FDLLICGDGSSDLYAQQVGLLVGEALNIPA
FIXA_SALNS      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSG-FDLLICGDGSSDLYAQQVGLLVGEALNIPA
FIXA_SALA4      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSG-FDLLICGDGSSDLYAQQVGLLVGEALNIPA
FIXA_SALG2      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSG-FDLLICGDGSSDLYAQQVGLLVGEALNIPA
FIXA_SALDC      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXKSG-FDLLICGDGSSDLYAQQVGLLVGEALNIPA
FIXA_ECOSM      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECO7I      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECOLI      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECOLC      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECOHS      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECODH      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECOBW      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECO57      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECO24      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_SHIFL      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_SHIF8      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECOSE      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECOLU      KDVLSRGPDELIVVIDDQFERXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECO8A      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ECO55      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILNIPA
FIXA_ESCF3      KDVLSRGPDELIVVIDDQFEXXXXXXXXXXXXXXXXXXG-FDLILCGDGSSDLYAQQVGLLVGEILDIPV
ETFB_DICDI      RTAIAMGADKGIHVETT--AELQPLSVAKLLKELVDKEKP-NLIILGKQAIDDDCNQTAQMLAGLLNWPQ
ETFB_BRAJA      RTGLAMGADRGILVK------AEGTVEPLAVAKILKKVAEEELIILGKQAIDDDSNQTGQMLAALLGWSQ
ETFB_ARATH      RTGLAMGADRGIHVETNS------IFLPLTIAKILKSLADVELIFLGKQAIDDDCNQTGQMVAALLGWPQ
YDIQ_ECOLI      KDVLSRGPHSLYLVQDAQLEHALPLDTAKALAAAIEKIG-FDLLIFGEGSGDLYAQQVGLLVGEILQLP-
ETFB_BOVIN      RTALAMGADRGIHVAEANHLGP--LQVARVLAKLAEK-EKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ
ETFB_RAT        RTALAMGADRGIHV---EVPGAEALQVARVLAKLAEK-EKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQ
ETFB_YEAST      RNCLAKGIDTCSLIDSVGKENIEPLAIAKILKAVVEKKGS-NLVLMGKQAIDDDCNNTGQMLAGLLNWPQ
ETFB_MOUSE      RTALAMGADRGIHV---EIPGAQALQVARVLAKLAEK-EKVDLLFLGKQAIDDDCNQTGQMTAGLLDWPQ
ETFB_PSEAE      RTALALGADRAILVESNDELNS--LAVAKLLKAVVDK-EQPQLVILGKQAIDSDNNQTGQMLAALTGYAQ
ETFB_PARDE      RTALAMGADRAILVVAADDVQQDIEPXXXXXXXXXXXXXETELIIAGKQAIDNDMNATGQMLAAILGWAQ
ETFB_ORYSJ      RTALAMGADRAVHVLHDPDPSRPLLPLAVAILRALALQENPGLVILGKQAIDDDCNQTGQMLAGLLNWPQ
ETFB_HUMAN      RTALAMGADRGIHVEPAEAERLGPLQVARVLAKLAEK-EKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ
ETFB_PONAB      RTALAMGADRGIHVEPAEAERLGPLQVARVLAKLAEK-EKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ
ETFB_PIG        RTALAMGADRGIHVEVPAAEAHHLLQVARVLAKLAQK-EKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQ
ETFB_METME      RKCLAKGXXXXXXXXXXXXEGSDAIVVGRILTEVIKKEAP-DMVFAGVQSSDQAYASTGISVASYLNWPH
ETFB_SCHPO      RQCLAKGIGRAALINVGE-KELEPLSVAKLLKATVEK-EKSNLVLLGKQAIDDDAHQTGGMLAAMLGWPQ
ETFB_ORYSI      RTALAMGADRAVHVLHDPDPSRPLLPLAVAILRALALQENPGLVILGKQAIDDDCNQTGQMLAGLLNWPQ
MINE_BORA1      ------------------------------------------IILAHERSGRGDSPDYLPQLQQEL----
SYA_SILST       GETYSIELCGGTHVKQTGDIGTFVILGDSASSAGVRR---------------------------------
YGCR_ECOLI      RYLMALGFEEAVLLE----TAADLRFAPEFVARHIAEWNPLDLIITGCQSSEGQNGQTPFLLAEMLGWPC
MRD1_ASPFU      -----------------------------------------------KRKRDGDNTQKDPQLQEYLSVIE
MINE_BORPD      ------------------------------------------IILAHERSGRGASPDYLPQLQQEL----


                         +         .         .         .         .         *         .:210
query           VANVRRILDVNDDFIKVEMDMPNTIEVLEVKYPCLLTVDKDIFQPRLPSYKKKLETDEREINVISLNDFE
ETFB_CLOTS      VTYVRKV-EIEGDKLIVERALEDGYEIIEVKTPVLLTAIKELNVPRYPSIKGIFNANKKEVKILTADDLE
ETFB_CLOAB      VTYVEKV-EVDGDTLKIRKAWEDGYEVVEVKTPVLLTAIKELNVPRYMSVEKIFGAFDKEVKMWTADDI-
FIXA_RHISN      LTYVAKVIDLRTRAITVERRAEGGTHVLKSELPCLITMLEGSNAIRRGSLDDALRAARSEIVKWNAVEAG
FIXA_AZOVI      LTYVSRIVDVDKKEIQVERRAEGGVQLLETSLPCLITMLEGTNEMRFGDLDDLFRAARHELKVWDRVAAG
ETFB_MEGEL      ITYARDI-KVEGDKVTVQQENEEGYIVTEAQFPVLITAVKDLNEPRFPTIRGTMKAKRREIPNL-XXXXX
FIXA_AZOC5      LTYVAKIVDLAGRSIQVERRSEGGVQVLQTRLPCLITMLEATNEIXXXXXXXXXXXXXXEVVIWSAKDAG
FIXA_BRAJA      VAKVRSV-DVANETIEAERRSEGGVQVLHTRLPCLITMLEATNQIXXXXXXXXXXXXXXKIVKWSAQDAG
FIXA_RHILP      LTYVAKIVDINGREITVERRSEGGTQTLMSKLPCLITMLEGTNEIRRGSLDDALRAARSQIVKWNAADAG
FIXA_RHIME      LTYVAKILDAASREITVERRAEGGSQILRTGLPCLVTMLXXXXXXXXXXXXXXXXXXXTKVVKWSAADAG
ETFB_MYCTU      LTHLRKV-SIEGGKITGERETDEGVFTLEATLPAVISVNEKINEPRFPSFKGIMAAKKKEVTVLTL----
ETFB_MYCBO      LTHLRKV-SIEGGKITGERETDEGVFTLEATLPAVISVNEKINEPRFPSFKGIMAAKKKEVTVLTL----
ETFB_MYCLE      LTHLRTI-SVEGGKITGERETDEGVFTLEAVLPAVVSVNEKINEPRFPSFKGIMAAKKKEVTVLTL----
FIXA_ECOL6      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECO45      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECO27      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
ETFB_BACSU      ITTITK-LEINGTDAEAERDVEGDVEKIKTTLPLLVTAQQGLNEPRYPS---------------------
FIXA_ECOL5      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECO81      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_SALTY      INGVSKILSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADI-
FIXA_SALTI      INGVSKILSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADI-
FIXA_SALPK      INGVSKILSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADI-
FIXA_SALPB      INGVSKILSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADI-
FIXA_SALPA      INGVSKILSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADI-
FIXA_SALNS      INGVSKILSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADI-
FIXA_SALA4      INGVSKILSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADI-
FIXA_SALG2      INGVSKILSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADI-
FIXA_SALDC      INGVSKILSLTDSTLTVERELEDEVETLSIPLPAVIAVSTDINTPQIPSMKAILGAAKKPVQVWSPADI-
FIXA_ECOSM      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECO7I      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECOLI      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECOLC      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECOHS      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECODH      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECOBW      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECO57      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECO24      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_SHIFL      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADFN
FIXA_SHIF8      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADFN
FIXA_ECOSE      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADFN
FIXA_ECOLU      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIG
FIXA_ECO8A      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADFN
FIXA_ECO55      VNGVSKIISLTADTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADFN
FIXA_ESCF3      VNGVSKIISLTTDTLTVERELEDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAAD--
ETFB_DICDI      ATFASKV-DIKDDSVHVTREIDGGLETLSMKLPAIISCDLRLNEPRYAKLQNIMKSKKAELKV-------
ETFB_BRAJA      -ATFASKLEVEGSDFKVTREVDGGLQTVKLKGPAIVTTDLRLNEPRYASLPNIMKAKKKPIAEKTVADY-
ETFB_ARATH      ATFASKVLDKDKNVATVDREVDGGLETLNVDLPAVITTDLRLNQPRYASLPNIMKAKSKPIKKMTVQDLK
YDIQ_ECOLI      VINAVSAIQRQGNTLVIERTLEDDVEVIELSVPAVLCVTSDINVPRIPSMKAILGAGKKPVNQWQASDID
ETFB_BOVIN      GTFASQV-TLEGDKIKVEREIDGGLETLRLKLPAVVTADLRLNEPR------------------------
ETFB_RAT        GTFASQV-TLEGDKVKVEREIDGGLETIRLKLPAVVTADLRLNEPR------------------------
ETFB_YEAST      ATNAAKVEFLDNGRVQVTREIDDGEEVIEASLPMVITTDLRLNTPRYVGLPKLMKAKKKPIEKLDIKDFP
ETFB_MOUSE      GTFASQV-TLEGDKVKVEREIDGGLETLRLKLPAVVTADLRLNEPR------------------------
ETFB_PSEAE      GTFASKV-EVAGDKVNVTREIDGGLQTVALNLPAIVTTDLRLNEPRYASLPNIMKAKKKPLDVVT-----
ETFB_PARDE      ATFASKV-EIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPL--------D
ETFB_ORYSJ      GTFASKVI-LNKEKATVEREVDGGIETISLDLPAVITTDLRLNQPRYATLPNIMKAKSKVIKKVTPEDLD
ETFB_HUMAN      GTFASQVT-LEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPR------------------------
ETFB_PONAB      GTFASQVT-LEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPR------------------------
ETFB_PIG        GTFASQVT-LEGDKVKVEREIDGGLETLRLKLPAVVTADLRLNEPR------------------------
ETFB_METME      VADLQYKPGDNKAVIRRELE-GGMLQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADI-
ETFB_SCHPO      FTSASKV-RIEGDKVIVTREIDGGEETLSSTLPAIITTDLRLNVPRFANLAKVMKARKAPLGKMSPED--
ETFB_ORYSI      GTFASKVI-LNKEKATVEREVDGGIETISLDLPAVITTDLRLNQPRYATLPNIMKAKSKVIKKVTPEDLD
MINE_BORA1      VAVISKYVKINPDDIKVHLERQDTLEVLEVK---------------------------------------
SYA_SILST       ----------------------------------------------------------------------
YGCR_ECOLI      FTQVER-FTLDALFITLEQRTEHGLRCCRVRLPAVIAVRQEVALP-VPGMRQRMAAGKAEI---------
MRD1_ASPFU      RPSKTKTWANGDDFLNTIQNQPATSELREEQRDDTSESHKQRKKPRVDDVPKAAHDREPEPMVL------
MINE_BORPD      VAVISKYVNINPDDIKVHLERQDTLEVLEVK---------------------------------------


                         .         .         .         +         .         .         .:280
query           DKDEKKYGLNGSPTQVERIFPPSNNDDHEIWTGDSSELSERMEDKLRELKFI
ETFB_CLOTS      -VDKNELGLKGSPTKVVATSTPNTERAGEIFTGNIKEAVQNLVERL------
ETFB_CLOAB      DVDKANLGL-------------------------------------------
FIXA_RHISN      IEDITKCGLRGSPTVVKRVFAPTPREQKAV---QIDTVEKAMQDVANEL---
FIXA_AZOVI      IDTVEMIGLKGSPTVVSKVFAP------------------------------
ETFB_MEGEL      XXXXXQIGLSGSPTKVRKIFPPQRSGGLVLKVEDDNEIVDQVMEKLVAQKII
FIXA_AZOC5      VEDISKCGLRGSPTIVKRVFAPS-----------------------------
FIXA_BRAJA      VEDISKCGLKGSPTVVKRVFAP------------------------------
FIXA_RHILP      IEDLTKCGLRGSPTVVKRVFAP------------------------------
FIXA_RHIME      IAEPANCGLRGSPTVVKRVFAPTSRE--------------------------
ETFB_MYCTU      ----------------------------------------------------
ETFB_MYCBO      ----------------------------------------------------
ETFB_MYCLE      ----------------------------------------------------
FIXA_ECOL6      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECO45      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECO27      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
ETFB_BACSU      ----------------------------------------------------
FIXA_ECOL5      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECO81      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_SALTY      -------GLNSVPASAQQVAAPKQREQRVVIEGDGEEQIAAFVENLRKI---
FIXA_SALTI      -------GLNSVPASTQQVAAPKQREQRVVIEGDGEEQIAAFVENLRKI---
FIXA_SALPK      -------GLNSVPASTQQVAAPKQREQRVVIEGDGEEQIAAFVENLRKI---
FIXA_SALPB      -------GLNSVPASAQQVAAPKQREQRVVIEGDGEEQIAAFVENLRKI---
FIXA_SALPA      -------GLNSVPASTQQVAAPKQREQRVVIEGDGEEQIAAFVENLRKI---
FIXA_SALNS      -------GLNSVPASAQQVAAPKQREQRVVIEGDGEEQIAAFVENLRKI---
FIXA_SALA4      -------GLNSVPASAQQVAAPKQREQRVVIEGDGEEQIAAFVENLRKI---
FIXA_SALG2      -------GLNSSAYSTQQVAAPKQREQRVVIEGDGEEQIAAFVENLRKI---
FIXA_SALDC      -------GLNSSAYSTQQVAAPKQREQRVVIEGDGEEQIAAFVENLRKI---
FIXA_ECOSM      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECO7I      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECOLI      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECOLC      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECOHS      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECODH      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECOBW      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECO57      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECO24      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_SHIFL      AVDAWSEQQVAAPKQRER----------------------------------
FIXA_SHIF8      AVDAWSEQQVAAPKQRER----------------------------------
FIXA_ECOSE      AVDAWSEQQVAAPKQRER----------------------------------
FIXA_ECOLU      FNAEAAW----SEQQVAA--PKQRERQRIVIEGDGEEQIAAFAENLRKV---
FIXA_ECO8A      AVDAWSEQQVAAPKQRER----------------------------------
FIXA_ECO55      AVDAWSEQQVAAPKQRER----------------------------------
FIXA_ESCF3      ----------------------------------------------------
ETFB_DICDI      ----------------------------------------------------
ETFB_BRAJA      ----------------------------------------------------
ETFB_ARATH      ----------------------------------------------------
YDIQ_ECOLI      ------WSQSAPLAELVGIVPPQTERKHIIIDNDSPEAIAELAEHLKK----
ETFB_BOVIN      ----------------------------------------------------
ETFB_RAT        ----------------------------------------------------
ETFB_YEAST      E---------------------------------------------------
ETFB_MOUSE      ----------------------------------------------------
ETFB_PSEAE      ----------------------------------------------------
ETFB_PARDE      EKTAADYGVDVAP---------------------------------------
ETFB_ORYSJ      ----------------------------------------------------
ETFB_HUMAN      ----------------------------------------------------
ETFB_PONAB      ----------------------------------------------------
ETFB_PIG        ----------------------------------------------------
ETFB_METME      GLSANDVGAAQSMSRVRRMYIPEKGRATMI-EGTISEQAAKIIQIINEFK--
ETFB_SCHPO      ----------------------------------------------------
ETFB_ORYSI      ----------------------------------------------------
MINE_BORA1      ----------------------------------------------------
SYA_SILST       ----------------------------------------------------
YGCR_ECOLI      ----------------------------------------------------
MRD1_ASPFU      DKTEEEHERANADGQVEAI-PPTQEEAEPVSDAD------------------
MINE_BORPD      ----------------------------------------------------