[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB80033.1

[Show Plain Result]


## Summary of Sequence Search
    1::171
    1::171     3e-85 100%  171 aa  LACB_CLOPE RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     3e-72  75%  171 aa  LACB1_STRP3 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-72  74%  171 aa  LACB_STRZT RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-72  74%  171 aa  LACB_STRZP RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-72  74%  171 aa  LACB_STRZJ RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-72  74%  171 aa  LACB_STRR6 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-72  74%  171 aa  LACB_STRPS RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-72  74%  171 aa  LACB_STRPN RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-72  74%  171 aa  LACB_STRPJ RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-72  74%  171 aa  LACB_STRPI RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-72  74%  171 aa  LACB_STRP7 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-72  74%  171 aa  LACB_STRP4 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-72  74%  171 aa  LACB_STRP2 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     7e-72  74%  171 aa  LACB_STRPG RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     7e-72  74%  171 aa  LACB1_STRPM RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     7e-72  74%  171 aa  LACB1_STRP6 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     7e-72  74%  171 aa  LACB1_STRP1 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAAW RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAAU RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAAT RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAAS RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAAR RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAAN RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAAM RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAAE RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAAC RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAAB RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAA9 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAA8 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAA3 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAA2 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-71  72%  171 aa  LACB_STAA1 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     3e-71  74%  171 aa  LACB1_STRP8 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-71  74%  171 aa  LACB_STRS7 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     6e-71  74%  171 aa  LACB_STRE4 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     1e-70  73%  171 aa  LACB_STRSV RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-70  73%  171 aa  LACB_STREM RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     1e-68  72%  171 aa  LACB_STRSY RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     1e-68  72%  171 aa  LACB_STRS2 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     3e-67  70%  171 aa  LACB_LACLA RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-67  70%  171 aa  LACB1_STRA3 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-66  66%  171 aa  LACB_STAES RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-66  66%  171 aa  LACB_STAEQ RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     3e-66  70%  171 aa  LACB_STRA5 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     3e-66  70%  171 aa  LACB_STRA1 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     3e-66  70%  171 aa  LACB2_STRA3 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     6e-66  67%  171 aa  LACB_STRMU RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     6e-66  66%  171 aa  LACB_STAHJ RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     8e-66  70%  171 aa  LACB_ENTFA RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-51  57%  171 aa  LACB2_STRP3 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     3e-51  58%  171 aa  LACB_STRPC RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     3e-51  58%  171 aa  LACB_STRPB RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     3e-51  58%  171 aa  LACB2_STRP1 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-51  57%  171 aa  LACB2_STRPM RecName: Full=Galactose-6-phosphate isomerase subunit
    1::170     2e-50  57%  173 aa  LACB_CLOAB RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     2e-50  57%  171 aa  LACB2_STRP6 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171     4e-50  56%  171 aa  LACB2_STRP8 RecName: Full=Galactose-6-phosphate isomerase subunit
    3::129     2e-23  40%  149 aa  RPIB_ECOLI RecName: Full=Ribose-5-phosphate isomerase B;       
    5::132     5e-17  37%  152 aa  RPIB_MYCGE RecName: Full=Probable ribose-5-phosphate isomerase B;  
    1::129     6e-16  31%  149 aa  YWLF_BACSU RecName: Full=Putative sugar phosphate isomerase ywlF;  
    6::131     7e-16  32%  144 aa  Y299_RICPR RecName: Full=Putative sugar phosphate isomerase RP299; 
    6::131     7e-16  32%  144 aa  Y290_RICTY RecName: Full=Putative sugar phosphate isomerase RT0290;
    6::131     9e-16  31%  144 aa  Y402_RICCN RecName: Full=Putative sugar phosphate isomerase RC0402;
   12::132     6e-15  32%  145 aa  Y486_RICFE RecName: Full=Putative sugar phosphate isomerase
    6::131     6e-15  32%  144 aa  Y278_RICBR RecName: Full=Putative sugar phosphate isomerase
    4::128     2e-14  32%  162 aa  RPIB_MYCTU RecName: Full=Ribose-5-phosphate isomerase B;       
    4::128     2e-14  32%  162 aa  RPIB_MYCBO RecName: Full=Ribose-5-phosphate isomerase B;       
    4::128     7e-14  31%  162 aa  RPIB_MYCLE RecName: Full=Ribose-5-phosphate isomerase B;       
    1::125     2e-13  31%  159 aa  RPIB_MYCPA RecName: Full=Ribose-5-phosphate isomerase B;       
    7::133     1e-12  31%  152 aa  RPIB_MYCPN RecName: Full=Probable ribose-5-phosphate isomerase B;  
    1::126     1e-10  33%  142 aa  LACA2_STRPM RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     1e-10  33%  142 aa  LACA2_STRP8 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     1e-10  33%  142 aa  LACA2_STRP6 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     1e-10  33%  142 aa  LACA2_STRP3 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     3e-10  30%  141 aa  LACA_STREM RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     3e-10  33%  141 aa  LACA_STRE4 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     5e-10  29%  142 aa  LACA_CLOPE RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     5e-10  31%  142 aa  LACA2_STRP1 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     2e-09  33%  141 aa  LACA_LACLA RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     2e-09  29%  141 aa  LACA1_STRPM RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     2e-09  29%  141 aa  LACA1_STRP1 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-09  32%  142 aa  LACA_STRMU RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     2e-09  28%  141 aa  LACA1_STRP6 RecName: Full=Galactose-6-phosphate isomerase subunit
   12::136     3e-09  28%  310 aa  DR102_ARATH RecName: Full=DNA-damage-repair/toleration protein
    1::126     5e-09  31%  142 aa  LACA_STAES RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     5e-09  31%  142 aa  LACA_STAEQ RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     7e-09  28%  141 aa  LACA_STRS7 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     9e-09  28%  141 aa  LACA1_STRP3 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     9e-09  31%  141 aa  LACA1_STRA3 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAAW RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAAU RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAAT RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAAS RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAAR RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAAN RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAAM RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAAE RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAAC RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAAB RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAA9 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAA8 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAA3 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAA2 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     2e-08  27%  142 aa  LACA_STAA1 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     2e-08  28%  141 aa  LACA1_STRP8 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     4e-08  32%  142 aa  LACA_CLOAB RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     6e-08  31%  142 aa  LACA_STAHJ RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     7e-08  28%  141 aa  LACA_STRZT RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     7e-08  28%  141 aa  LACA_STRPJ RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     7e-08  30%  141 aa  LACA_STRA5 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     7e-08  30%  141 aa  LACA_STRA1 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     7e-08  30%  141 aa  LACA2_STRA3 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     9e-08  28%  141 aa  LACA_STRZP RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     9e-08  28%  141 aa  LACA_STRZJ RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     9e-08  28%  141 aa  LACA_STRR6 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     9e-08  28%  141 aa  LACA_STRPS RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     9e-08  28%  141 aa  LACA_STRPI RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     9e-08  28%  141 aa  LACA_STRP4 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     9e-08  28%  141 aa  LACA_STRP2 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     1e-07  28%  141 aa  LACA_STRPN RecName: Full=Galactose-6-phosphate isomerase subunit
    1::125     4e-07  28%  141 aa  LACA_STRP7 RecName: Full=Galactose-6-phosphate isomerase subunit
    1::126     3e-06  28%  142 aa  LACA_ENTFA RecName: Full=Galactose-6-phosphate isomerase subunit
    1::171

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKIAIGCDHIVTDTKIAVSDFLKAKGYDVLDVGTYDFTRTHYPIFGKKVGEAVASGEADLGVCICGTGVG
LACB_CLOPE      MKIAIGCDHIVTDTKIAVSDFLKAKGYDVLDVGTYDFTRTHYPIFGKKVGEAVASGEADLGVCICGTGVG
LACB1_STRP3     MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDYGTYDHTRTHYPIFGKKVGEAVVSGQADLGVCICGTGVG
LACB_STRZT      MRIAIGCDHIVTDEKMAVSEFLKSKGYEVIDFGTYDHTRTHYPIFGKKVGEAVTSGQADLGVCICGTGVG
LACB_STRZP      MRIAIGCDHIVTDEKMAVSEFLKSKGYEVIDFGTYDHTRTHYPIFGKKVGEAVTSGQADLGVCICGTGVG
LACB_STRZJ      MRIAIGCDHIVTDEKMAVSEFLKSKGYEVIDFGTYDHTRTHYPIFGKKVGEAVTSGQADLGVCICGTGVG
LACB_STRR6      MRIAIGCDHIVTDEKMAVSEFLKSKGYEVIDFGTYDHTRTHYPIFGKKVGEAVTSGQADLGVCICGTGVG
LACB_STRPS      MRIAIGCDHIVTDEKMAVSEFLKSKGYEVIDFGTYDHTRTHYPIFGKKVGEAVTSGQADLGVCICGTGVG
LACB_STRPN      MRIAIGCDHIVTDEKMAVSEFLKSKGYEVIDFGTYDHTRTHYPIFGKKVGEAVTSGQADLGVCICGTGVG
LACB_STRPJ      MRIAIGCDHIVTDEKMAVSEFLKSKGYEVIDFGTYDHTRTHYPIFGKKVGEAVTSGQADLGVCICGTGVG
LACB_STRPI      MRIAIGCDHIVTDEKMAVSEFLKSKGYEVIDFGTYDHTRTHYPIFGKKVGEAVTSGQADLGVCICGTGVG
LACB_STRP7      MRIAIGCDHIVTDEKMAVSEFLKSKGYEVIDFGTYDHTRTHYPIFGKKVGEAVTSGQADLGVCICGTGVG
LACB_STRP4      MRIAIGCDHIVTDEKMAVSEFLKSKGYEVIDFGTYDHTRTHYPIFGKKVGEAVTSGQADLGVCICGTGVG
LACB_STRP2      MRIAIGCDHIVTDEKMAVSEFLKSKGYEVIDFGTYDHTRTHYPIFGKKVGEAVTSGQADLGVCICGTGVG
LACB_STRPG      MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDCGTYDHTRTHYPIFGKKVGEAVVNGQADLGVCICGTGVG
LACB1_STRPM     MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDCGTYDHTRTHYPIFGKKVGEAVVNGQADLGVCICGTGVG
LACB1_STRP6     MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDCGTYDHTRTHYPIFGKKVGEAVVNGQADLGVCICGTGVG
LACB1_STRP1     MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDCGTYDHTRTHYPIFGKKVGEAVVNGQADLGVCICGTGVG
LACB_STAAW      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAAU      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAAT      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAAS      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAAR      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAAN      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAAM      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAAE      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAAC      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAAB      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAA9      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAA8      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAA3      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAA2      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB_STAA1      MKIALGCDHIVTDTKMRVSEFLKSKGHEVIDVGTYDFTRTHYPIFGKKVGEQVVSGNADLGVCICGTGVG
LACB1_STRP8     MKIAIGCDHIVTNEKMAVSDFLKSKGYDVIDCGTYDHTRTHYPIFGKKVGEAVVNEQADLGVCICGTGVG
LACB_STRS7      MKIAIGCDHIVTDEKMAVSDFLKSKGYEVIDCGTYDHTRTHYPIFGKRVGEAVANGLADLGVCICGTGVG
LACB_STRE4      MKIAIGCDHIVTDEKMAVSDFLKSKGYEVIDCGTYDHTRTHYPIFGKRVGEAVANGLADLGVCICGTGVG
LACB_STRSV      MKIAIGCDHIVTNEKMAVSDFLKSKGYEVLDFGTYDHTRTHYPIFGKKVGEAVVSGQADLGVCICGTGVG
LACB_STREM      MKIAIGCDHIVTNEKMAVSDFLKSKGYEVIDCGTYDHTRTHYPIFGKRVGEAVANGRADLGVCICGTGVG
LACB_STRSY      MKIAIGCDHIVTYEKIAVVDYLKNQGYEVLDFGTYDNVRTHYPIFGKKVGEAVVSGQADLGICICGTGVG
LACB_STRS2      MKIAIGCDHIVTYEKIAVVDYLKNQGYEVLDFGTYDNVRTHYPIFGKKVGEAVVSGQADLGICICGTGVG
LACB_LACLA      MRIAIGCDHIVTDVKMAVSEFLKSKGYEVLDFGTYDHVRTHYPIYGKKVGEAVVSGQADLGVCICGTGVG
LACB1_STRA3     MKIAIGCDHIVTNEKMAVVDFLKSKGYEVQDYGTYDHVRTHYPIYGKKVGEAVASGKAELGICICGTGVG
LACB_STAES      MKIAIGCDHIVTDTKMEVSQHLKSQGHEVIDVGTYDFTRTHYPIYGKKVGEKVASGEADLGVCICGTGVG
LACB_STAEQ      MKIAIGCDHIVTDTKMEVSQHLKSQGHEVIDVGTYDFTRTHYPIYGKKVGEKVASGEADLGVCICGTGVG
LACB_STRA5      MKIAVGCDHIVTYDKIAVVDYLKTKGYEVIDCGTYDNIRTHYPIYGKKVGEAVASGKADLGVCICGTGVG
LACB_STRA1      MKIAVGCDHIVTYDKIAVVDYLKTKGYEVIDCGTYDNIRTHYPIYGKKVGEAVASGKADLGVCICGTGVG
LACB2_STRA3     MKIAVGCDHIVTYDKIAVVDYLKTKGYEVIDCGTYDNIRTHYPIYGKKVGEAVASGKADLGVCICGTGVG
LACB_STRMU      MKIAIGCDHIVTDVKMELSKHLKEEGYEVLDVGTYDFTRTHYPIFGKKVGEAVSSGEADLGVCMCGTGVG
LACB_STAHJ      MKIAIGCDHIVTDTKMEVSQHLKAQGHEVIDVGTYDFTRTHYPIFGKKVGEKVASGEADLGVCICGTGVG
LACB_ENTFA      MKIAIGCDHIVTDTKIAVSDFLKAKGYEILDVGTYDFTRTHYPIFGKKVGEAVMSNQADLXXXXXXXXXX
LACB2_STRP3     MKIAVGCDHIVTYEKIAVVDYLKTQGHEIIDCGTYDNVRTHYPIFGKKVGEAVASGEAELXXXXXXXXXX
LACB_STRPC      MKIAVGCDHIVTYEKIAVVDYLKSQGHKVIDCGTYDNVRTHYPIFGKKVGEAVASGEAELXXXXXXXXXX
LACB_STRPB      MKIAVGCDHIVTYEKIAVVDYLKSQGHKVIDCGTYDNVRTHYPIFGKKVGEAVASGEAELXXXXXXXXXX
LACB2_STRP1     MKIAVGCDHIVTYEKIAVVDYLKSQGHKVIDCGTYDNVRTHYPIFGKKVGEAVASGEAELXXXXXXXXXX
LACB2_STRPM     MKIAVGCDHIVTYEKIAVVDYLKSQGHEIIDCGTYDNVRTHYPIFGKKVGEAVASGEAELXXXXXXXXXX
LACB_CLOAB      MVISIGCDHIVPDIKMKISEYLKSKGHTVIDNGTYDFVRTHYPIFGKAAAEKVASGEADLGVILCGTGVG
LACB2_STRP6     MKIAVGCDHIVTYEKIAVVDYLKSQGHKVIDCGTYDNVRTHYPIFGKKVGEAVASGKAELXXXXXXXXXX
LACB2_STRP8     MKIAVGCDHIVTYEKIAVVDYLKTQGHEIIDCGTYDNVRTHYPIFGKKVGEAVASGKAELXXXXXXXXXX
RPIB_ECOLI      -KIAFGCDHVGFILKHEIVAHLVERGVEVIDKGTWSSERTDYPHYASQVALAVAGGEVDGGILICGTGVG
RPIB_MYCGE      --IFIASDHTGLTLKKIISEHLKTKQFNVVDLGNYFDANDDYPDFAFLVADKVKNSDKDLGILICGTGVG
YWLF_BACSU      MKVAIASDHGGVHIRNEIKELMDELQIEYIDMGCCGSGSVDYPDYAFPVAEKVVSGEVDRGILICGTGIG
Y299_RICPR      --IVIASDHSGYELKSKIINYLEQKCLNIYDCGTQDTQTVDYPDYAKKVVDIIIEKAAPIGILISDTGIG
Y290_RICTY      --IVIASDHSGYELKSKIINYLEQKCLNIYDCGTQDTQTVDYPDYAKKVVDIIIEKAAPIGILISDTGIG
Y402_RICCN      --IVIASDHSGYELKSEIINYLEQKSLKIYDCGTNNTQTVDYPDYAKKVVDIIIEKSAPIGILISDTGIG
Y486_RICFE      -------DHSGYELKSEIINYLEQKSLKVYDCGTNNTQTVDYPDYAKKVVDIIIEKSAPIGILISDTGIG
Y278_RICBR      --IVIASDHSGYELKSIIIEYLQKKSLSVYDCGTHNTQSVDYPDYAKKVVNNIIEKLARIGILIGDTGIG
RPIB_MYCTU      MRVYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDYPAFCIAAATRTVADPGSLGIVLGGSGNG
RPIB_MYCBO      MRVYLGADHAGYELKQRIIEHLKQTGHEPIDCGALRYDADDYPAFCIAAATRTVADPGSLGIVLGGSGNG
RPIB_MYCLE      MRVYLGADHAGYELKRQIIEHLKQSGHQPIDCGAFSYVDDEYPAFCITAATRTVADPGSLGIVLGGSGNG
RPIB_MYCPA      MRVYLGSDHAGFELKQQIIAHLEQSGHQPIDCGAFSYDADDYPAFCIAAATRTVADPDSLGIVLGGSGNG
RPIB_MYCPN      --IYIASDHTGLELKSLVIKHLEQQKLQVIDLGPTELDPLDYPDYAFLLAQTMQANPNSLGILICGTGVG
LACA2_STRPM     MAIIIGADKAGQELKEVIKDYLKEGKYEVVDVSVRDFVDTTLA-----VAKEVNASEDNLGIVIDAYGVG
LACA2_STRP8     MAIIIGADKAGQELKEVIKDYLKEGKYEVVDVSVRDFVDTTLA-----VAKEVNASEDNLGIVIDAYGVG
LACA2_STRP6     MAIIIGADKAGQELKEVIKDYLKEGKYEVVDVSVRDFVDTTLA-----VAKEVNASEDNLGIVIDAYGVG
LACA2_STRP3     MAIIIGADKAGQELKEVIKDYLKEGKYEVVDVSVRDFVDTTLA-----VAKEVNASEDNLGIVIDAYGVG
LACA_STREM      MAIILGADAHGNELKEVLKSFLQQEGFDVTDVTDIDKDFIDNTL---AVAQAVNDKDTNLGIMVDAYGAG
LACA_STRE4      MTIILGADAHGNDLKEAIKGFLQQEGFDVTDVTAIDFVDNTLA-----VARALKADEESLGIMIDAYGAG
LACA_CLOPE      MRVVIGADKEGMELKNMIKCYLLENNFEVIDKSSEDFVESTVAIT-----KDVLENKGSLGIAFDGYGAG
LACA2_STRP1     MAIIIGADKAGQELKEVIKDYLKEGKYEVVDVSVRDFVDTTLAVV-----KEVNASDDNLGIVIDAYGVG
LACA_LACLA      MAIVVGADLKGTRLKDVVKNFLVEEGFEVIDVTKQDFVDVTLA-----VASEVNKDEQNLGIVIDAYGAG
LACA1_STRPM     MAIILGADAHGNALKELIKSFLQEEGYDIIDVTDINSDFIDNTL---AVAKAVNEAEGRLGIMVDAYGAG
LACA1_STRP1     MAIILGADAHGNALKELIKSFLQEEGYDIIDVTDINSDFIDNTL---AVAKAVNEAEGRLGIMVDAYGAG
LACA_STRMU      MAIIIGSDAAGKRLKDVIKTFLKDNNHEVLDVTELDFVDSTLAVVHE-----VQKNDKNLGIAIDAYGAG
LACA1_STRP6     MAIILGADAHGNALKELIKSFLQEEGYDIIDVTDINSDFIDNTL---AVAKAINEAEGRLGIMVDAYGAG
DR102_ARATH     LKIITGADDFGASLKDAMVTHLRSLGIDVEDTGVSSY---YSAXXXXXXXXXXXXXXXXXXLVCCGTGVG
LACA_STAES      MTIIIGSDVDGKRLKELIKDYLEDNDYDVLDVTELDFVDSTV-----SVAKEVQKSDDNLGIAIDAYGAG
LACA_STAEQ      MTIIIGSDVDGKRLKELIKDYLEDNDYDVLDVTELDFVDSTV-----SVAKEVQKSDDNLGIAIDAYGAG
LACA_STRS7      MAIILGADAHGNELKEVLKGFLQQEGFDVTDVTDIDKDFIDNTL---AVAQAVNDKDTNLGIMVDAYGAG
LACA1_STRP3     MAIILGADAHGNALKELIKSFLQEESYDIIDVTDINSDFIDNTL---AVAKAVNEAEGRLGIMVDAYGAG
LACA1_STRA3     MAIIIGADTAGSKLKDVVKDFLVGENFEVVDVTQQDFVDVTLAVAAE-----VNKQEENLGIVIDAYGAG
LACA_STAAW      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAAU      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGTG
LACA_STAAT      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAAS      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAAR      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAAN      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAAM      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAAE      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAAC      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAAB      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAA9      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAA8      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAA3      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAA2      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA_STAA1      MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVT--EGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGAG
LACA1_STRP8     MAIILGADAHGNALKELIKSFLQEESYDIIDVTDINSDFIDNTL---AVAKAVNEAEGRLGIMVDAYGAG
LACA_CLOAB      MKIAIGADTDGFELKEHLKNYLKSKGIEVIDKTPEK--GINLVKSASLVAQAVMNKEADRAVAIDEYGAG
LACA_STAHJ      MTIFIGSDVAGQRLKDVVKTFLKENNHDVVDVTELDFVDSTLAVVHE-----VQKNDDNLGIAVDAYGAG
LACA_STRZT      MSIVIGADAAGLRLKEVVKDFLEKENFHLVDVTAQDFVDVTLAVAAE-----VNKEEQNLGIVIDAYGAG
LACA_STRPJ      MSIVIGADAAGLRLKEVVKDFLEKENFHLVDVTAQDFVDVTLAVAAE-----VNKEEQNLGIVIDAYGAG
LACA_STRA5      MTIIIGADAHGVELKEVIRQHLTSLGKEIIDLTSKDFVDNTLAIVAK-----VNQKEDNLGIMVDAYGVG
LACA_STRA1      MTIIIGADAHGVELKEVIRQHLTSLGKEIIDLTSKDFVDNTLAIVAK-----VNQKEDNLGIMVDAYGVG
LACA2_STRA3     MTIIIGADAHGVELKEVIRQHLTSLGKEIIDLTSKDFVDNTLAIVAK-----VNQKEDNLGIMVDAYGVG
LACA_STRZP      MSIVIGADAAGLRLKEVVKDFLEKENFHLVDVTAQDFVDVTLAVAAE-----VNKEEQNLGIVIDAYGAG
LACA_STRZJ      MSIVIGADAAGLRLKEVVKDFLEKENFHLVDVTAQDFVDVTLAVAAE-----VNKEEQNLGIVIDAYGAG
LACA_STRR6      MSIVIGADAAGLRLKEVVKDFLEKENFHLVDVTAQDFVDVTLAVAAE-----VNKEEQNLGIVIDAYGAG
LACA_STRPS      MSIVIGADAAGLRLKEVVKDFLEKENFHLVDVTAQDFVDVTLAVAAE-----VNKEEQNLGIVIDAYGAG
LACA_STRPI      MSIVIGADAAGLRLKEVVKDFLEKENFHLVDVTAQDFVDVTLAVAAE-----VNKEEQNLGIVIDAYGAG
LACA_STRP4      MSIVIGADAAGLRLKEVVKDFLEKENFHLVDVTAQDFVDVTLAVAAE-----VNKEEQNLGIVIDAYGAG
LACA_STRP2      MSIVIGADAAGLRLKEVVKDFLEKENFHLVDVTAQDFVDVTLAVAAE-----VNKEEQNLGIVIDAYGAG
LACA_STRPN      MSIVIGADAAGLRLKEVVKDFLEKENFHLVDVTAQDFVDVTLAVAAE-----VNKEEQNLGIVIDAYGAG
LACA_STRP7      MSIVIGADAAGLRLKEVVKNFLEKENFHLVDVTAQDFVDVTLAVAAE-----VNKEEQNLGIVIDAYGAG
LACA_ENTFA      MRVILGSDLDGIKLKAEMKQYLLQEKVEVIDKSSEDFIEATLA-----VAHEVLKDTESLGIVFDGYGAG


                         .         .         *         .         .         .         .:140
query           INNAVNKVPGIRSALVRDMTTAIYAKEQLNANVIGFGGKITGEFLMCDIIEAFIKADYXXXXXXXXXXXX
LACB_CLOPE      INNAVNKVPGIRSALVRDMTTAIYAKEQLNANVIGFGGKITGEFLMCDIIEAFIKADYXXXXXXXXXXXX
LACB1_STRP3     INNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAK
LACB_STRZT      INNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKLIAK
LACB_STRZP      INNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKLIAK
LACB_STRZJ      INNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPTEENKKLIAK
LACB_STRR6      INNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKLIAK
LACB_STRPS      INNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKLIAK
LACB_STRPN      INNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPTEENKKLIAK
LACB_STRPJ      INNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKLIAK
LACB_STRPI      INNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKLIAK
LACB_STRP7      INNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKLIAK
LACB_STRP4      INNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPTEENKKLIAK
LACB_STRP2      INNAVNKVPGVRSALVRDMTTALYAKEQLNANVIGFGGKITGELLMCDIIEAFIHAEYKPSEENKKLIAK
LACB_STRPG      INNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAK
LACB1_STRPM     INNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAK
LACB1_STRP6     INNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAK
LACB1_STRP1     INNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAK
LACB_STAAW      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAK
LACB_STAAU      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAK
LACB_STAAT      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAK
LACB_STAAS      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAK
LACB_STAAR      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAK
LACB_STAAN      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKATEENKKLIAK
LACB_STAAM      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKATEENKKLIAK
LACB_STAAE      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAK
LACB_STAAC      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAK
LACB_STAAB      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAK
LACB_STAA9      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKATEENKKLIAK
LACB_STAA8      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAK
LACB_STAA3      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKPTEENKKLIAK
LACB_STAA2      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKATEENKKLIAK
LACB_STAA1      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGRIIGELLMCDIIDAFINAEYKATEENKKLIAK
LACB1_STRP8     INNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKAEYKETEENKKLIAK
LACB_STRS7      ITNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIEAFIKAEYKETEENKKLIAK
LACB_STRE4      ITNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIEAFIKADYKETEENKKLIAK
LACB_STRSV      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGKITGELLICDIIEAFIHAEYKPTEENKKLIAK
LACB_STREM      INNAVNKVSGIRSALVRDMTTALYAKEELNANVIGFGGKITGELLMCDIIDAFIKADYRETDDNKKLLAK
LACB_STRSY      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGKITGELLMCDIIEAFIKAEYKPTEENKRLIEK
LACB_STRS2      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGKITGELLMCDIIEAFIKAEYKPTEENKRLIEK
LACB_LACLA      INNAVNKVPGVRSALVRDMTSALYAKEELNANVIGFGGMITGGLLMNDIIEAFIEAEYKPTEENKKLIAK
LACB1_STRA3     INNAVNKVPGIRSALVRDMTSALYAKEELNANVIGFGGKITGELLMCDIIEALLHAEYKPSEENKKLIAK
LACB_STAES      ISNAANKVPGVRTALVRDMTSALYSKEELNANVVSFGGKVAGELFIFDIVDAFIEAEYKPTEENKKLIAK
LACB_STAEQ      ISNAANKVPGVRTALVRDMTSALYSKEELNANVVSFGGKVAGELFIFDIVDAFIEAEYKPTEENKKLIAK
LACB_STRA5      INNAVNKVPGIRSALVRDLTSAIYAKEELNANVIGFGGKITGGLLMTDIIEAFIRAKYKPTKENKVLIEK
LACB_STRA1      INNAVNKVPGIRSALVRDLTSAIYAKEELNANVIGFGGKITGGLLMTDIIEAFIRAKYKPTKENKVLIEK
LACB2_STRA3     INNAVNKVPGIRSALVRDLTSAIYAKEELNANVIGFGGKITGGLLMTDIIEAFIRAKYKPTKENKVLIEK
LACB_STRMU      ISNAANKVPGVRTALVRDMTSALYSKEELNANVVSFGGAIIGKLLLFDIVDAFIKAQYKPTEENKKLIAK
LACB_STAHJ      ISNAANKVPGVRTALVRDMTSALYSKEELNANVVSFGGKVAGELFIFDIVDAFIKAEYKPTEENKKLIAK
LACB_ENTFA      XXNAVNKVPGIRSALVRDMTTALYAKEELNANVIGFGGKITGEFLICDIAAAFIEAHYHPTEDNEQLIEK
LACB2_STRP3     XXNAVNKVPGIRSALVRDMTSAIYSKEELNANVXXXXXXXXXXLLMNDIIDAFLAAEYKPTEENKKWIEK
LACB_STRPC      XXNAVNKVPGIRSALVRDMTSAIYSKEELNANVXXXXXXXXXXLLMNDIIDAFLAAEYKPTEENKKWIEK
LACB_STRPB      XXNAVNKVPGIRSALVRDMTSAIYSKEELNANVXXXXXXXXXXLLMNDIIDAFLAAEYKPTEENKKWIEK
LACB2_STRP1     XXNAVNKVPGIRSALVRDMTSAIYSKEELNANVXXXXXXXXXXLLMNDIIDAFLAAEYKPTEENKKWIEK
LACB2_STRPM     XXNAVNKVPGIRAALVRDMTSAIYSKEELNANVXXXXXXXXXXLLMNDIIDAFLAAEYKPTEENKKWIEK
LACB_CLOAB      ISNSANKVKGIRAALVRDVGTARYAKEYLNANVIAVGGRITGIGLIENIIDVFLEAKYKPTKENQEIIKG
LACB2_STRP6     XXNAVNKVPGIRAALVRDMTSAIYSKEELNANVXXXXXXXXXXLLMNDIIDAFLAAEYKPTEENKKWIEK
LACB2_STRP8     XXNAVNKVPGIRAALVRDMTSAIYSKEELNANVXXXXXXXXXXLLMNDIIDAFLAAEYKPTEENKKWIEK
RPIB_ECOLI      ISIAANKFAGIRAVVCSEPYSAQLSRQHNDTNVLAFGSRVVGLELAKMIVDAWLGAQY------------
RPIB_MYCGE      VCMAANKVKGVLAALVVSEKTAALARQHDNANVLCLSSRFVTDSENIKIVDDFLKANF------------
YWLF_BACSU      MSISANKVKGIRCALAHDTFSAKATREHNDTNILAMGERVIGPGLAREIAKIWLTTEF------------
Y299_RICPR      MSIAANRSSEIRAALCNDILTAENAKAHNDANILILGAKSVDNKIVFNIIDKFLTTKF------------
Y290_RICTY      MSIAANRSSEIRAALCNDILTAENAKAHNDANILILGAKSVDNKIVFNIIDKFLTTKF------------
Y402_RICCN      MSIAANRSSEIRAALCNNILTAENAKAHNDANILILGAKTIDQKIVFDIIDKFLTTQF------------
Y486_RICFE      MSIAANRSSEIRAALCHNMLTAENAKAHNDANILILGAKTIDYKIVFDIIDKFLTTKF------------
Y278_RICBR      MSIAANRSSEIRAALCVNVSTAESAKAHNDANILVLGAKTVDHKTVFDIIDKFLATKF------------
RPIB_MYCTU      EQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFV----------------
RPIB_MYCBO      EQIAANKVPGARCALAWSVQTAALAREHNNAQLIGIGGRMHTVAEALAIVDAFV----------------
RPIB_MYCLE      EQIAANKVVGARCALAWSVETARLAREHNNAQLIGIGGRMHTVAEALTIVDAFV----------------
RPIB_MYCPA      EQIAANKVPGARCALAWSVETAQLAREHNNAQLIGIGGRMHTVAEALAIVDAFV----------------
RPIB_MYCPN      VCMAANKAKGILAALVVDSKTAALARQHDDANVLCLSSRFVVPEENIKIVDEFLQAQF------------
LACA2_STRPM     SFMVATKIKGMVAAEVSDERSAYMTRGHNNARIITLGSEISAPGIAKNIIKGFVEGKY------------
LACA2_STRP8     SFMVATKIKGMVAAEVSDERSAYMTRGHNNARIITLGSEISAPGIAKNIIKGFVEGKY------------
LACA2_STRP6     SFMVATKIKGMVAAEVSDERSAYMTRGHNNARIITLGSEISAPGIAKNIIKGFVEGKY------------
LACA2_STRP3     SFMVATKIKGMVAAEVSDERSAYMTRGHNNARIITLGSEISAPGIAKNIIKGFVEGKY------------
LACA_STREM      PFMVATKLKGMIAAEVSDERSAYMTRGHNNARMITLGARIVGEELAKNIAKAFVVGSY------------
LACA_STRE4      PFMVATKIKGMVAAEVSDERSAYMTRGHNNARMITMGAEIVGQELAKNIAKGFVTGHY------------
LACA_CLOPE      SFMVATKIKGIIAAEVSDERSAYMTREHNNSSIITIGSKIVGSELALNIVKEFLEASY------------
LACA2_STRP1     SFMVATKIKGMVAAEVSDERSAYMTRGHNNARIITLGSEISAPGIAKNIIKGFVEGKY------------
LACA_LACLA      PFMVATKIKGMVAAEVSDERSAYMTRGHNNARMITVGAEIVGDELAKNIAKAFVNGKY------------
LACA1_STRPM     PFMVATKLKGMVAAEVSDERSAYMTRGHNNARMITIGAEIVGPELAKNIVKGFVTGPY------------
LACA1_STRP1     PFMVATKLKGMVAAEVSDERSAYMTRGHNNARMITIGAEIVGPELAKNIVKGFVTGPY------------
LACA_STRMU      SFMVATKVKGMIAAEVSDERSAYMTRGHNNARIITLGAEIVGDELAKNIVKDFVEAKY------------
LACA1_STRP6     PFMVATKLKGMVAAEVSDERSAYMTRGHNNARMITIGAEIVGPELAKNIVKGFVTGPY------------
DR102_ARATH     VAMFANKFPGVYAATCLSVEDAVNARSISNCNVLAFSGIKTSPETALEIFDAWIKTPF------------
LACA_STAES      SFIVATKIKGMIAAEVSDERSAYMTRSHNNARMITMGAEIVGDTLAKNVAKEFVNGHY------------
LACA_STAEQ      SFIVATKIKGMIAAEVSDERSAYMTRSHNNARMITMGAEIVGDTLAKNVAKEFVNGHY------------
LACA_STRS7      PFMVATKLKGMIAAEVSDERSAYMTRGHNNARMMTMGAEIVGQELAKNIAKGFVTGHY------------
LACA1_STRP3     PFMVATKLKGMVAAEVSDERSAYMTRGHNNARMITIGAEIVGPELAKNIVKGFVTGPY------------
LACA1_STRA3     PFMVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGSEIVGEGLAKNIAKGFVNGKY------------
LACA_STAAW      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAAU      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAAT      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAAS      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAAR      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAAN      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAAM      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAAE      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAAC      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAAB      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAA9      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAA8      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAA3      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAA2      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA_STAA1      SFMVATKIKGMIAAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKY------------
LACA1_STRP8     PFMVATKLKGMVAAEVSDERSAYMTRGHNNARMITMGAEIVGPELAKNIAKGFVTGPY------------
LACA_CLOAB      SFMVGAKHKGIICAEVSDEHSAKMTSQHNSANMLAIGAGIVGKRLAEGMLDAYIAEKY------------
LACA_STAHJ      SFIVATKVKGMIAAEVSDERSAYMTRSHNNACMITMGSEIVGDTLAKNIAKEFVNGHY------------
LACA_STRZT      PFIVATKIKGMVAAEVSDERSAYMTRSHNNSRMITMGAQLVGDELAKNIAKGFVNGKY------------
LACA_STRPJ      SFMVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKY------------
LACA_STRA5      PFMVATKVKGMIAAEVSDERSAYMTRAHNNARMITLGSEIVGPGVAKHIVEGFVDGTY------------
LACA_STRA1      PFMVATKVKGMIAAEVSDERSAYMTRAHNNARMITLGSEIVGPGVAKHIVEGFVDGTY------------
LACA2_STRA3     PFMVATKVKGMIAAEVSDERSAYMTRAHNNARMITLGSEIVGPGVAKHIVEGFVDGTY------------
LACA_STRZP      PFMVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKY------------
LACA_STRZJ      PFMVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKY------------
LACA_STRR6      PFMVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKY------------
LACA_STRPS      PFMVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKY------------
LACA_STRPI      PFMVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKY------------
LACA_STRP4      PFMVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKY------------
LACA_STRP2      PFMVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKY------------
LACA_STRPN      PFIVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKY------------
LACA_STRP7      PFMVATKIKGMVAAEVSDERSAYMTRGHNNSRMITMGAQLVGDELAKNIAKGFVNGKY------------
LACA_ENTFA      SFMTAAKIKGMIVAELSDERSAYMAREHNNARMITVGAKIVGTELAKNIIKEFLTGHY------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXPEQNDIHFFDEFLERWNRGEYKD
LACB_CLOPE      XXXXXXXXPEQNDIHFFDEFLERWNRGEYKD
LACB1_STRP3     IAHLESHHANQEDPDFFTEFLEKWDRGEYHD
LACB_STRZT      IEHVETHNAQQTDANFFTEFLEKWDRGEYHD
LACB_STRZP      IEHLESHNAQQTDANFFTEFLEKWDRGEYHD
LACB_STRZJ      IEHVESHNAQQTDANFFTEFLEKWDRGEYHD
LACB_STRR6      IEHLESHNAQQTDANFFTEFLEKWDRGEYHD
LACB_STRPS      IEHLESHNAQQTDANFFTEFLEKWDRGEYHD
LACB_STRPN      IEHVESHNAQQTDANFFTEFLEKWDRGEYHD
LACB_STRPJ      IEHLESHNAQQTDANFFTEFLEKWDRGEYHD
LACB_STRPI      IEHLESHNAQQTDANFFTEFLEKWDRGEYHD
LACB_STRP7      IEHLESHNAQQTDANFFTEFLEKWDRGEYHD
LACB_STRP4      IEHVESHNAQQTDANFFTEFLEKWDRGEYHD
LACB_STRP2      IEHLESHNAQQTDANFFTEFLEKWDRGEYHD
LACB_STRPG      IAHLETHHANQEDPDFFTEFLEKWDRGEYHD
LACB1_STRPM     IAHLESHHANQEDPDFFTEFLEKWDRGEYHD
LACB1_STRP6     IAHLESHHANQEDPDFFTEFLEKWDRGEYHD
LACB1_STRP1     IAHLESHHANQEDPDFFTEFLEKWDRGEYHD
LACB_STAAW      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAAU      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAAT      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAAS      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAAR      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAAN      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAAM      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAAE      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAAC      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAAB      IKHLETRNADQADPHFFDEFLEKWDRGEYHD
LACB_STAA9      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAA8      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAA3      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAA2      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB_STAA1      IKHLETSNADQADPHFFDEFLEKWDRGEYHD
LACB1_STRP8     IAHLESHHASQEDPDFFTEFLERWDRGEYHD
LACB_STRS7      IAHLESHNANQEDPDFFTEFLEKWDRGEYHD
LACB_STRE4      IAHLESHNANQEDPDFFTEFLDKWDRGDYHD
LACB_STRSV      IEHVETHNAHQADDNFFTEFLEKWDRGEYHD
LACB_STREM      IAHLETQHVNQEDPDFFNEFLDKWDRGDYQD
LACB_STRSY      IAAVETLNQEQANPEFFTEFLEKWDRGEYHD
LACB_STRS2      IAAVETLNQEQANPEFFTEFLEKWDRGEYHD
LACB_LACLA      IEHVETHNAHQADEEFFTEFLEKWDRGEYHD
LACB1_STRA3     IAHVESKNDNQTNPDFFKEFLEKWDRGEYHD
LACB_STAES      INHLEAHNNDQADPHFFDEFLEKWNKGEYHD
LACB_STAEQ      INHLEAHNNDQADPHFFDEFLEKWNKGEYHD
LACB_STRA5      IAEVETHNAHQEENDFFTEFLDKWNRGEYHD
LACB_STRA1      IAEVETHNAHQEENDFFTEFLDKWNRGEYHD
LACB2_STRA3     IAEVETHNAHQEENDFFTEFLDKWNRGEYHD
LACB_STRMU      IKHLEAHNDKQADPHFFDEFLEKWNRGDYHD
LACB_STAHJ      INHLEAHNDNQANPHFFDEFLEKWDKGKYHD
LACB_ENTFA      INQVEKQHPEQQDAHFFDEFLDKWQRGVYHD
LACB2_STRP3     MDSLQHASQDQNNPHFFDEFLEKWDRGEYHD
LACB_STRPC      MDSLQHASQDQNNPHFFDEFLEKWDRGEYHD
LACB_STRPB      MDSLQHASQDQNNPHFFDEFLEKWDRGEYHD
LACB2_STRP1     MDSLQHASQDQNNPHFFDEFLEKWDRGEYHD
LACB2_STRPM     MDSLQHASQDQNNPHFFDEFLEKWDRGEYHD
LACB_CLOAB      IDELIENDKGQGNEHFFDEFIEKWDNGGY--
LACB2_STRP6     MDSLQHTNQDQNNPHFFDEFLEKWDRGEYHD
LACB2_STRP8     MDSLQHASQDQNNPHFFDEFLEKWVRGEYHD
RPIB_ECOLI      -------------------------------
RPIB_MYCGE      -------------------------------
YWLF_BACSU      -------------------------------
Y299_RICPR      -------------------------------
Y290_RICTY      -------------------------------
Y402_RICCN      -------------------------------
Y486_RICFE      -------------------------------
Y278_RICBR      -------------------------------
RPIB_MYCTU      -------------------------------
RPIB_MYCBO      -------------------------------
RPIB_MYCLE      -------------------------------
RPIB_MYCPA      -------------------------------
RPIB_MYCPN      -------------------------------
LACA2_STRPM     -------------------------------
LACA2_STRP8     -------------------------------
LACA2_STRP6     -------------------------------
LACA2_STRP3     -------------------------------
LACA_STREM      -------------------------------
LACA_STRE4      -------------------------------
LACA_CLOPE      -------------------------------
LACA2_STRP1     -------------------------------
LACA_LACLA      -------------------------------
LACA1_STRPM     -------------------------------
LACA1_STRP1     -------------------------------
LACA_STRMU      -------------------------------
LACA1_STRP6     -------------------------------
DR102_ARATH     -------------------------------
LACA_STAES      -------------------------------
LACA_STAEQ      -------------------------------
LACA_STRS7      -------------------------------
LACA1_STRP3     -------------------------------
LACA1_STRA3     -------------------------------
LACA_STAAW      -------------------------------
LACA_STAAU      -------------------------------
LACA_STAAT      -------------------------------
LACA_STAAS      -------------------------------
LACA_STAAR      -------------------------------
LACA_STAAN      -------------------------------
LACA_STAAM      -------------------------------
LACA_STAAE      -------------------------------
LACA_STAAC      -------------------------------
LACA_STAAB      -------------------------------
LACA_STAA9      -------------------------------
LACA_STAA8      -------------------------------
LACA_STAA3      -------------------------------
LACA_STAA2      -------------------------------
LACA_STAA1      -------------------------------
LACA1_STRP8     -------------------------------
LACA_CLOAB      -------------------------------
LACA_STAHJ      -------------------------------
LACA_STRZT      -------------------------------
LACA_STRPJ      -------------------------------
LACA_STRA5      -------------------------------
LACA_STRA1      -------------------------------
LACA2_STRA3     -------------------------------
LACA_STRZP      -------------------------------
LACA_STRZJ      -------------------------------
LACA_STRR6      -------------------------------
LACA_STRPS      -------------------------------
LACA_STRPI      -------------------------------
LACA_STRP4      -------------------------------
LACA_STRP2      -------------------------------
LACA_STRPN      -------------------------------
LACA_STRP7      -------------------------------
LACA_ENTFA      -------------------------------