[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for cper0:BAB80140.1

[Show Plain Result]


## Summary of Sequence Search
    1::162
  195::251     1e-04  39%  273 aa  MAK3_XENLA RecName: Full=N-acetyltransferase MAK3 homolog;       
  210::342     1e-04  31%  364 aa  MAK3_MOUSE RecName: Full=N-acetyltransferase MAK3 homolog;       
  208::340     1e-04  31%  362 aa  MAK3_HUMAN RecName: Full=N-acetyltransferase MAK3 homolog;       
   79::151     3e-04  36%  159 aa  GNA1_YEAST RecName: Full=Glucosamine 6-phosphate
   69::123     5e-04  43%  148 aa  RIMI_SHIFL RecName: Full=Ribosomal-protein-alanine
   69::123     5e-04  43%  148 aa  RIMI_ECOLI RecName: Full=Ribosomal-protein-alanine
   69::123     5e-04  43%  148 aa  RIMI_ECOL6 RecName: Full=Ribosomal-protein-alanine
   69::123     5e-04  43%  148 aa  RIMI_ECO57 RecName: Full=Ribosomal-protein-alanine
  266::355     5e-04  28%  377 aa  MAK3_DROME RecName: Full=N-acetyltransferase MAK3 homolog;       
   67::145     6e-04  34%  167 aa  YJGM_SALTY RecName: Full=Uncharacterized N-acetyltransferase yjgM; 
   77::145     8e-04  34%  167 aa  YJGM_ECOLI RecName: Full=Uncharacterized N-acetyltransferase yjgM; 
    1::162

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGDENNWAYIQYSAGVFKDYQLAIRRIFKEENSLK
MAK3_XENLA      ----------------------------------------------------------------------
MAK3_MOUSE      ------------------------------------GEDRTIRYVRYESELMPDIMRLITKDLSEPYSIY
MAK3_HUMAN      ------------------------------------GEDRTIRYVRYESELMPDIMRLITKDLSEPYSIY
GNA1_YEAST      ----------------------------------------------------------------------
RIMI_SHIFL      ----------------------------------------------------------------------
RIMI_ECOLI      ----------------------------------------------------------------------
RIMI_ECOL6      ----------------------------------------------------------------------
RIMI_ECO57      ----------------------------------------------------------------------
MAK3_DROME      ----------------------------------------------------------------------
YJGM_SALTY      ----------------------------------------------------------------------
YJGM_ECOLI      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GNFKNRCVFLENENGERIGTIMIVPSLSEEEGVQEIKYLALLPKYQEQGLGKLLISKAYKMVDDVEGATR
MAK3_XENLA      -----------------------------------IAMLAVDSKYRRKGIGTHLVKKAYAMVEGDCDEVV
MAK3_MOUSE      TNWPQLC-FLAMVGEECVGAI--VCKLDMHKKMFRRGYIAMLAKYRRNGIGTNLVKKAYAMVEGDCDEVV
MAK3_HUMAN      TNWPQLC-FLAMVGEECVGAI--VCKLDMHKKMFRRGYIAMLAKYRRNGIGTNLVKKAYAMVEGDCDEVV
GNA1_YEAST      ------------------GNIIIERKIIHELGLGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDY-GCYK
RIMI_SHIFL      --------------------------------------IAVDPDYQRQGLGRALLE---HLIDELEGVAT
RIMI_ECOLI      --------------------------------------IAVDPDYQRQGLGRALLE---HLIDELEGVAT
RIMI_ECOL6      --------------------------------------IAVDPDYQRQGLGRALLE---HLIDELEGVAT
RIMI_ECO57      --------------------------------------IAVDPDYQRQGLGRALLE---HLIDELEGVAT
MAK3_DROME      -NWPKLC-FLASHDNQYVGAIVCKLDMHMNVRRGYIAMLAVRKEYRKLKIGTTLVTKAIEMLADNADEVV
YJGM_SALTY      ------------QNGCVVGGGGVAPLSCSEPDICELQKMYFLPVIRGQGLAKKLALMALDHARE-QGFKR
YJGM_ECOLI      ----------------------IAPLTGSESDICELQKMYFLPAIRGKGLAKKLALMAMEQAREM-GFKR


                         +         .         .         .         .         *         .:210
query           INLEAYNDKSIVLFENLGFERS
MAK3_XENLA      LETEITNKSALKLYENLGFVR-
MAK3_MOUSE      LETEITNKSALKLYENLGFVR-
MAK3_HUMAN      LETEITNKSALKLYENLGFVR-
GNA1_YEAST      IILDC-DEKNVKFYEKCGFSNA
RIMI_SHIFL      LWLEASNAAAIALYESLGFNEA
RIMI_ECOLI      LWLEASNAAAIALYESLGFNEA
RIMI_ECOL6      LWLEASNAAAIALYESLGFNEA
RIMI_ECO57      LWLEASNAAAIALYESLGFNEA
MAK3_DROME      LETEMRNQPALRLYENLGFVR-
YJGM_SALTY      CYLEAFLREAIALYERLGFE--
YJGM_ECOLI      CYLEAFLKEAIALYEHLGFE--